Identifiers and Description

Gene Model Identifier

Contig6383.0.g23

Standard Name

UBP1c

Aliases

Contig6383_0_g23

Description

U-box domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam04564 ) U-box domain
  • ( pfam04641 ) Replication termination factor 2
  • ( pfam13445 ) RING-type zinc-finger, LisH dimerisation motif
  • ( pfam11789 ) Zinc-finger of the MIZ type in Nse subunit
  • ( pfam04977 ) Septum formation initiator

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001610500.000000019990673443141236hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig6383.0.g23(coding)
ATGTAAACTTTGAAGAATGCATTTCCGTAGATTGAGTAACTTTTAGTGGAGGACTTTCTG
ATCTATATGTCGGCAGGTTTGGTATTTGGAGTGACCGCGATCTCAGTAGTTAAGTTCATG
AACAGTAGGAAGATAGGCTAAGGGCTTTTGAGGAAGTTGGGATTAAGCAGCGCCAGAATA
GGAGCAGATGGAGGGCTCTTTGGGGGCTGTGGAGAAACTTTCGGAGATATGACCACGCCC
AAATGTACCTACCAATGCACCTGTTGCAGGATTCAAAAGAAGACACCAACCAAAAAGCCT
CTTGACATAAACCACGACACATGTTTAGAGGACACTCCAGAAGGAGAGGAAGGCTGCCTC
TGGAAGAACTTTGAGGTTTGGTCATTCTACTGCCCAATTTCCAACTAACTTATCGAGGAC
CCAGTCATCAGCAAATACGGCCACATCTACAATAGAAAAAGCATCTAAGAATGGATTAAA
ATCAAAGGCATCTGTCCTTTTTCTTACCAGAAACTTACAAATGATGACCTGATTCCGATA
TACTCCCTGAAAGCAGACATCTATGAGTACAAGAAACGCATCAGATCTTTACAAGAAAAA
CAAAAGTAGCTTGAGCAAGAATAGTAAGAAAAACTAAAAAGTAGCAGTAATGAAAGTATA
TTGAAAGCTGAGGAAGATGGCAAGTCTGCGGAAATTAGTTCCATTTCTCCACTCAGCAGA
TCCACTCAGTAATGA


>Contig6383.0.g23(protein)
MQTLKNAFPQIEQLLVEDFLIYMSAGLVFGVTAISVVKFMNSRKIGQGLLRKLGLSSARI
GADGGLFGGCGETFGDMTTPKCTYQCTCCRIQKKTPTKKPLDINHDTCLEDTPEGEEGCL
WKNFEVWSFYCPISNQLIEDPVISKYGHIYNRKSIQEWIKIKGICPFSYQKLTNDDLIPI
YSLKADIYEYKKRIRSLQEKQKQLEQEQQEKLKSSSNESILKAEEDGKSAEISSISPLSR
STQQ