Identifiers and Description

Gene Model Identifier

Contig16087.0.g105

Standard Name

UBP1b

Aliases

Contig16087_0_g105

Description

Ring finger domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam13639 ) Ring finger domain
  • ( pfam11789 ) Zinc-finger of the MIZ type in Nse subunit
  • ( pfam04641 ) Replication termination factor 2
  • ( pfam13923 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam13445 ) RING-type zinc-finger, LisH dimerisation motif
  • ( pfam12678 ) RING-H2 zinc finger
  • ( pfam13920 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam09723 ) Zinc ribbon domain
  • ( pfam00097 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam12861 ) Anaphase-promoting complex subunit 11 RING-H2 finger
  • ( pfam10571 ) Uncharacterised protein family UPF0547
  • ( pfam04423 ) Rad50 zinc hook motif
  • ( pfam04564 ) U-box domain
  • ( pfam10717 ) Occlusion-derived virus envelope protein ODV-E18
  • ( pfam11060 ) Protein of unknown function (DUF2861)
  • ( pfam05568 ) African swine fever virus J13L protein
  • ( pfam02891 ) MIZ/SP-RING zinc finger

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002194490.000009999254677478949phosphatidylinositol 4-kinase
SGDYDR143C0.000009999254677478949SAN1 SGDID:S000002550, Chr IV
from 743874-742042, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16087.0.g105(coding)
ATGTCAAGAGGTGTGGTTATTGCGATAGCAGTTGTGGGGGTTGCAATATTAGCATTAATC
GGCATTTTTGCAAGCTCAAGCGAAAATAAAGCATCGTCTACATCAGAAGAAAGCGTTGAA
GTATGCCCTATCACTTAGTAACCTATTAAAAAACGAATTCAAACAAAATGTGGTCATGTT
TTTGAAAAGAGTGCACTTGCTGAATGGAAAAAGAGCAAAACCTCGTGCCCTGTTTGTAGA
AAGAAATTATGA


>Contig16087.0.g105(protein)
MSRGVVIAIAVVGVAILALIGIFASSSENKASSTSEESVEVCPITQQPIKKRIQTKCGHV
FEKSALAEWKKSKTSCPVCRKKL