Identifiers and Description

Gene Model Identifier

Contig9849.0.g98

Standard Name

UBP1a

Aliases

Contig9849_0_g98

Description

U-box domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam04564 ) U-box domain
  • ( pfam11789 ) Zinc-finger of the MIZ type in Nse subunit
  • ( pfam13445 ) RING-type zinc-finger, LisH dimerisation motif
  • ( pfam13923 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam04375 ) HemX
  • ( pfam04156 ) IncA protein
  • ( pfam13639 ) Ring finger domain
  • ( pfam14283 ) Domain of unknown function (DUF4366)
  • ( pfam12678 ) RING-H2 zinc finger
  • ( pfam10199 ) Alpha and gamma adaptin binding protein p34
  • ( pfam12861 ) Anaphase-promoting complex subunit 11 RING-H2 finger
  • ( pfam11807 ) Domain of unknown function (DUF3328)
  • ( pfam05053 ) Menin
  • ( pfam10225 ) Uncharacterized conserved protein (DUF2215)
  • ( pfam07423 ) Protein of unknown function (DUF1510)
  • ( pfam09531 ) Nucleoporin protein Ndc1-Nup
  • ( pfam04391 ) Protein of unknown function (DUF533)
  • ( pfam09323 ) Domain of unknown function (DUF1980)
  • ( pfam13779 ) Domain of unknown function (DUF4175)
  • ( pfam04641 ) Replication termination factor 2

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003105400.0000000400154582995175U-box domain containing protei
n

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9849.0.g98(coding)
ATGGAAAAGAAAGAAAAGAACAACGAGAGAAACACTAACAGTGGTGGAGGTGGTCTTGGT
GGAGCTCTCCTGACTATTGGAGTTGCAGCAGCAGTCGGCATAGGCTCATACTTCTTCGCC
AAGAAAATGGATGAAACATACAGCAAACCATCTTCAGAAAAATAGACGAACTAAGAAGAG
TACAAATCTCAAAACTAATAAAATGGCAATTCAGATAACCCATATGAAAGAGAGAGGCAA
GAAAACCTTAAAAATAAAGCTAATAAATAAAACACGAATTAAAATAGCATTTTGAGTAAT
AACGATTCAAACATGCAGTCTCTCAATCAAAGTAGTGCCACAACAGTTGACGATTTGGAG
TCATTCCTATGCCCAATCTCTCAGCAAATCATGATTGAACCTGTAATGACCATCTACGGC
CACTGTTTCGAAAAGAAAGTGATAATTGATTGGATCTAGAGAAAAGGCACGTGTCCCCTC
ACCAATTAGAAATTGACGGTTAATGACATATTTCCAGCATTCGCCCTTAAAAGTGCCATT
GATGAATATAGAAAGAAACATTAGATGTGA


>Contig9849.0.g98(protein)
MEKKEKNNERNTNSGGGGLGGALLTIGVAAAVGIGSYFFAKKMDETYSKPSSEKQTNQEE
YKSQNQQNGNSDNPYERERQENLKNKANKQNTNQNSILSNNDSNMQSLNQSSATTVDDLE
SFLCPISQQIMIEPVMTIYGHCFEKKVIIDWIQRKGTCPLTNQKLTVNDIFPAFALKSAI
DEYRKKHQM