Identifiers and Description

Gene Model Identifier

Contig13669.0.g43

Standard Name

UBE2QL1

Aliases

Contig13669_0_g43

Description

Poly(ADP-ribose) polymerase catalytic domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000304300.0007999190683310628WGR domain containing protein
SGDYOR339C0.0009001042212099794UBC11 SGDID:S000005866, Chr XV
from 958832-958362, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13669.0.g43(coding)
ATGGTCGACAAATTTTCTGACTAAAAACTCGAAAGCATTATTTAGAGCTGGCTCGAATCT
GAAGATGGTCAGTTGATCACAGATCAAATGACTATTCTTTTTGATGGAGTGAGGGGAAGC
CAAGCTAAATTCGAAATTGAAGAGAAATCTTTCAAACTCCTAATTGATCCATCGAATGCA
TGCCCAACCGAAGTTGAGTCCTCTAGCCAAAACTCTAAGATTCTTAATTTTATCGAAAAA
GTGAATGAAAAGCTGATAATGCGAGAGATACCAAAACTCGAAGATGGCTTGAAATTCGTA
CTCAGGACATTCAGCTAAACGGTTTTAGGATAAATGATAAATTAGATAACCCCAAACAAA
GGTGGTGGAGATTACGGAAATTAAGACGATGATTAGATGGAATTCTCGTACAATGAAAGT
TCCAACAGGAATAATGTGATAAATAATTATGGAGATGAAGAAGGTTCTGGATAGTGGGCG
GGATAAGACCAAGAAATGCAACAAGATGATGATGCAGTGGATTGGGGATTGGATGATGAT
GACAGTGGAGCTATGGATTACACAGGATAAATCTAGACAAATTTAGCTTAAGACAGATTG
AATGAGATCAAACAAATGGGCATATCAGACTCATCATCACTAATCCAAGGTGTCCTAAAC
TTTAAATCTGTGCGACTCTTTGAACAAACAAAGTTCTATAAGGATGCTTAACAGGCCCAA
GAATATTTGTTGTCAAATTAAGATAAAATTGAAGGTTGGTTGAATTTGGTCGTCACTAAA
GAGTTTCTAAACATAAGAATTGAGATTGACTTAAATTATGTTAACCTCCATCCTAGCAAC
ATTACAGTGCTAGGCTGGAAGATTGAGGAGCCACTAATCATTGTTCTTGACATTTCAGAA
CCTAAAATTCTTAATATAAATGAGAGTGAAGTTAAGAACCTTGATTTTAAGTAAATGTGG
AACTAGGGCATGATCCAGTATTAGTCACTTAATGCATCAAGCCCAGCTAGTTTCGGATGT
AATGACTACTTAAGAGAAGTTTTCAAGAGTTTTATTTCAGAGGTCTTAAACTCGTCAAGT
AACTTCAGCTCTTTGATGGAAGAAGAGAAAGAAAGTTCTTCACTTTTTAACAGAAGTAAG
CAAGAAGCTAAATTAGTTCAAGGGACTGGAAAGTTTCCCAAGAAGTCTTTCTGGAAGAAA
ATGTTTGGGCAAAGTAAAGTAGACGATGGCATGCTTGCTGAGTTAGTGAATATGGGCTTT
GATTCTGAAATTGCAGCCAAGGCTCTTCTAAAGTCAAACAATAATCTTGAAAAGGCAATT
GACATAATGAGTGAGCCTGAATTTCTAATTGAGCCTAGCTTAGTGAAACGTGCTTCAAAA
GATTACTCAATTATGAATCTTCCACATACCAAGAATCAATTGGTTAGAATGATGCTCTAC
ATATGTGATAGACTTGACAAATCAACTCGTTACTGCATTCTCTGTCATAATTAGCTCGAA
ACTGAAAGCATAAAATTGAGAGCTTGCACATCTGAACACTGCGAATTTATCTTCGAAGAG
AACTTTGGTGGAACTATCTTCCCAGAACTCAAATATAACCAGCATGAAGCATTCTTGAAT
ATTTCCCTTGCCGCTAAAGCCCTTTTCTCAACCAGAGCAGGATCAGTGTTCGAGCCATTC
CCAACTTTCTTCTTGATCTCAAATGAACTCAGAACTAAGAGAGGTAACTTAGATGTTATC
TAGAAAGCCAGAATAGAAGGAAACTAGGTCAACAAAGATCACATGGTCAACGAGAAGAAT
AAGGATTTGGCCAAAATGTTGGAAATCTTTCAAAAGATTCCTCCATACATGACACTAATG
AAAGATGTTAACAGTGAAGCTGATTTGATATGCAAACTCAACACCATTTACAAGAATGAG
ACACAAGCTCGATAATCTTATAAGATGCTCAGCTATATTTTAGCAACTAATAGATCCACA
TTTGTAAAACTAACTGAAGCTACCAACATAGATTTATCTCCTGGTGTTGTGAACAATGTA
AATAATGGTCAAGATCTTAGCTCTACTTTTGAGCAGTACTTGATTATCCCTCAGGACCAA
GCTAAGGAGAGGATTTTCAGACAAAGAAAGAAGCAGCATGGTTCTGTGTTTTGCTGGCAC
GGTAGTTCCACTGAGAACTGGTATTCTATTCTCAGGAATGGTTTGAGAAATGTGAGCAAC
ACAACTTTAATGACAGCAGGAGCAGCATATGGAGCTGGTATTTATGCCTCATCTAATTTT
TCTACTTCTTATGGCTACACAGCTCGCTACAGCTAAGGCAATAAATTTTGGCAACATGCC
AACCAATGGATAGGACAGTACTTCATAATTGCAGTGTGTGAGATCATTAAGAAGAAAGAG
TATGATAAAGCACCAACCTATGCTATTGCAGTAGTGCCTGATGAGGATGATATTATTATT
AGGTATCTCTTCATGATTAAGAATGGATAAATGTACTCAATTCCAAATATTGACACAAAT
AAAATTGACTTTGAGAATCACTACTATAGCTAACTCAGAACCATAAATACTTAGTTGGAA
GAACAGAGATAGCTTCGAATCAGTGAGGCATTTTCCAAATTCTAGTAGCGTCGTCAGAAG
CAGCAAGAAGAGCTTAAAAAGATCTAAGAGTAATCTTATGAGAAAATATAGAAAGCAGAA
GAGGAAGAATTGGAGAAGCAGTTCAAGTAGATGGCTGAAAGATTCACTGGAAAAGGATCA
CAGCTGTCTACTCAGAGAATCAGTAAAGACTATGTGGGACTCATGAAATCTTCAGAATTC
AAAGACAAGATCAAAGTTGAATTCTTTAAAAACAACATGTACATTTGGAAAGTAACCTTC
GATCTTATTGACTATGAAGTGAGCAATGACCTGAAGAACGACTTCAAACAGATAGCTAAG
TAGATTGGTGAAGACAAGGCAAAGTTACAATATGAAATGATCTTCTCTGATAAATATCCG
ATTGAACCACCTTTCGTGAGAGTGGTGTTCCCAAGATTTGCTTTCAGAACTGGTCATGTG
ACTGTAGGAGGCAGCATCTGTATTGAGAGTTTAACTCCTTCTGGCTGGTCAAGTGCTAGA
TCCCTTGAGAGTTATTTCGTGGAGATTGTATCACTGATAAATGCAGGAAACGCCAGATTG
GACTTGAACTCCCTTCAACCGTATTCTCTTCAAGAAGCCAAAGATGCTTTCAACAGAGTA
GCTAGAGATCATGGTTGGATAAAATGA


>Contig13669.0.g43(protein)
MVDKFSDQKLESIIQSWLESEDGQLITDQMTILFDGVRGSQAKFEIEEKSFKLLIDPSNA
CPTEVESSSQNSKILNFIEKVNEKLIMREIPKLEDGLKFVLRTFSQTVLGQMINQITPNK
GGGDYGNQDDDQMEFSYNESSNRNNVINNYGDEEGSGQWAGQDQEMQQDDDAVDWGLDDD
DSGAMDYTGQIQTNLAQDRLNEIKQMGISDSSSLIQGVLNFKSVRLFEQTKFYKDAQQAQ
EYLLSNQDKIEGWLNLVVTKEFLNIRIEIDLNYVNLHPSNITVLGWKIEEPLIIVLDISE
PKILNINESEVKNLDFKQMWNQGMIQYQSLNASSPASFGCNDYLREVFKSFISEVLNSSS
NFSSLMEEEKESSSLFNRSKQEAKLVQGTGKFPKKSFWKKMFGQSKVDDGMLAELVNMGF
DSEIAAKALLKSNNNLEKAIDIMSEPEFLIEPSLVKRASKDYSIMNLPHTKNQLVRMMLY
ICDRLDKSTRYCILCHNQLETESIKLRACTSEHCEFIFEENFGGTIFPELKYNQHEAFLN
ISLAAKALFSTRAGSVFEPFPTFFLISNELRTKRGNLDVIQKARIEGNQVNKDHMVNEKN
KDLAKMLEIFQKIPPYMTLMKDVNSEADLICKLNTIYKNETQARQSYKMLSYILATNRST
FVKLTEATNIDLSPGVVNNVNNGQDLSSTFEQYLIIPQDQAKERIFRQRKKQHGSVFCWH
GSSTENWYSILRNGLRNVSNTTLMTAGAAYGAGIYASSNFSTSYGYTARYSQGNKFWQHA
NQWIGQYFIIAVCEIIKKKEYDKAPTYAIAVVPDEDDIIIRYLFMIKNGQMYSIPNIDTN
KIDFENHYYSQLRTINTQLEEQRQLRISEAFSKFQQRRQKQQEELKKIQEQSYEKIQKAE
EEELEKQFKQMAERFTGKGSQLSTQRISKDYVGLMKSSEFKDKIKVEFFKNNMYIWKVTF
DLIDYEVSNDLKNDFKQIAKQIGEDKAKLQYEMIFSDKYPIEPPFVRVVFPRFAFRTGHV
TVGGSICIESLTPSGWSSARSLESYFVEIVSLINAGNARLDLNSLQPYSLQEAKDAFNRV
ARDHGWIK