Identifiers and Description

Gene Model Identifier

Contig16539.0.g115

Standard Name

UBE2A

Aliases

Contig16539_0_g115

Description

Ubiquitin-conjugating enzyme

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005507206.002203762674495e-72Ubiquitin-conjugating enzyme f
amily protein
SGDYGL058W1.0001055852164665e-60RAD6 SGDID:S000003026, Chr VII
from 393986-394504, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16539.0.g115(coding)
ATGAATTCGAACGCAGAAAGACGACTATTGAAAGACTTGAAGAAGCTGGAGACAGAAGAC
TCATCAGGCGGCATTACCGCTACTCCAGATGAAGACTCCTTGTACAGATGGAAAGCTGTG
ATATTTGGGCCTGACGAGACTGAGTGGGAAGGAGGAATTTTCAGACTTATCATGGAGTTC
ACAGAGGACTATCCAAACAAACCACCCAAAGTCAAGTTTCTGACGAGAATGTTCCACCCT
AACATCTACAACGATGGGTCAATATGTTTGGACATTTTACAGAACATGTGGTCTCCAGTA
TATGACATTTCGAGTATCCTGACTTCAATTCAATCTTTACTTTGTGACCCAAATACTAAA
TCCCCCGCAAATAACGAAGCAGCAGAAATGTACTCCAAAAATTACAAAGAATATGTTTAG
AGAGTGAAAGAAGTAGTAGAATAAAGCTTGCTAGATGATGATGGCGATACTCAAATGCAG
TGA


>Contig16539.0.g115(protein)
MNSNAERRLLKDLKKLETEDSSGGITATPDEDSLYRWKAVIFGPDETEWEGGIFRLIMEF
TEDYPNKPPKVKFLTRMFHPNIYNDGSICLDILQNMWSPVYDISSILTSIQSLLCDPNTK
SPANNEAAEMYSKNYKEYVQRVKEVVEQSLLDDDGDTQMQ