Identifiers and Description

Gene Model Identifier

Contig20855.0.g27

Standard Name

UBC9b

Aliases

Contig20855_0_g27

Description

Ubiquitin-conjugating enzyme

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYDL064W2.0007467515522948e-59UBC9 SGDID:S000002222, Chr IV
from 337487-337524,337635...
T. thermophilaTTHERM_005227209.999353957415832e-59Ubiquitin-conjugating enzyme f
amily protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20855.0.g27(coding)
ATGCAAATCGCTAAAGAACGTCTACTACAAGAGAGAAAGAACTGGAGGAAGGAGCATCCA
TTTGGCTTTGGAGCAAAACCCATGACAGGCGATGACAAGGAATCGTCCGACCTTTTCAGA
TGGGAATGCACTATTCCAGGCAAGCAAGGGTCTCCTTGGGAGGGTGGTGTGTACAAATTG
ACTATGGAGTTCAGTGAGGACTACCCCAACAAACCCCCAAAGTGCAAGTTCCAGCCAGTC
TTGTTTCACCCCAACATCTATCCTAGTGGCACAGTTTGCTTGAGCATCCTCAATGAAGAT
GAAGATTGGCGCCCATCACTCACTATCCCACAGATTCTGATCGGTATCCAAGACTTAATG
AACAATCCTAATGAGAAGAGTCCTGCACAAGCTGACCCCTACATCATGTTCACACAGAAT
AAGGCAGAGTACCTCCTTAGAGTCAGAAAGCAAGCGGAGGAGTGCAGACCCAAGGCATGA


>Contig20855.0.g27(protein)
MQIAKERLLQERKNWRKEHPFGFGAKPMTGDDKESSDLFRWECTIPGKQGSPWEGGVYKL
TMEFSEDYPNKPPKCKFQPVLFHPNIYPSGTVCLSILNEDEDWRPSLTIPQILIGIQDLM
NNPNEKSPAQADPYIMFTQNKAEYLLRVRKQAEECRPKA