Identifiers and Description

Gene Model Identifier

Contig3858.0.g34

Standard Name

UBC9a

Aliases

Contig3858_0_g34

Description

Ubiquitin-conjugating enzyme

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005227205.997545490783615e-57Ubiquitin-conjugating enzyme f
amily protein
SGDYDL064W6.001502944943701e-53UBC9 SGDID:S000002222, Chr IV
from 337487-337524,337635...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig3858.0.g34(coding)
ATGCAAATTGCTAAAGAACGACTACTATAAGAGAGAAAGAATTGGCGCAAAGATCACCCC
CATGGATTCGTAGCAAAGCCTCAAGTGACTTAAGATTAAGAAACTTCCTCTATTTTTACT
TGGGAATGTGTAATTCCTGGGGAAATAGACACAATTTGGGAAGGAGGAGAATATAAACTG
ATAATGGAATTCAGTGAGGACTATCCAAACAAACCGCCTAAATGCAAATTTGTTCAGAAA
TTATTTCATCCTAATATATACCCCAGCGGCACTGTATGCTTGAGTATACTTAACGAAGAT
GAAGACTGGCGTCCATCTCTCACAATACAATAGATTTTACTTGGAATACAGGATCTACTG
AAAAATCCGAATGAAAAAAGTCCAGCCTAGGCAGAACCATTTTTGCTATACACAAATGAT
AAAAAAGCTTACGAGGATAAAGTCAGATAGTAAGCATTAGAGTGCAAACCTAAAGATGAT
TGA


>Contig3858.0.g34(protein)
MQIAKERLLQERKNWRKDHPHGFVAKPQVTQDQETSSIFTWECVIPGEIDTIWEGGEYKL
IMEFSEDYPNKPPKCKFVQKLFHPNIYPSGTVCLSILNEDEDWRPSLTIQQILLGIQDLL
KNPNEKSPAQAEPFLLYTNDKKAYEDKVRQQALECKPKDD