Identifiers and Description

Gene Model Identifier

Contig13467.0.1.g50

Standard Name

UBC1d

Aliases

Contig13467_0_1_g50

Description

Ubiquitin-conjugating enzyme

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006286902.9994376937714457e-52Ubiquitin-conjugating enzyme f
amily protein
SGDYDR059C2.000704504372864e-47UBC5 SGDID:S000002466, Chr IV
from 569633-569234,569770...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13467.0.1.g50(coding)
ATGGACAGTAATGTCCTATCATTTTTAATAAATTATGTGAAGAATCAGAAAGAGAAGCAG
TAGTACCTCAAAAGTTTAATTGAAGAAAATAAGAATAAGCATATCCTGATTGATCTCAGC
GATAAAGATGACTTAAGCTTAACATCTAATAGTCATAATGAGAACACTCATAATACTTAA
CAAGATACTAAAGATACCACTATTTGTGAGAAAACCATCAATTTTGCCAGAATCGATCAA
AACTAGGAATAAAATGACATACTCAAATATAATACAAGCTTAACCTCAAGTACATTACCC
CAATAAGATTAAGTATAAACTTTAACTTCCAAAGCAACTCCATCAAAAAAGGATATTTAA
AAGCTGCTAAAATCAAGTGAGGTTATCTTAAATGATGAAGCCTACATTGAGAGTAAAATT
ATTTATTCTGCAAGAACTCAAAAAAGGAAAGGCTGTTACTCAACTGTCAAAGATCTATGG
TTGGGATAACCTACAAATAATCTCAGTAAAAAATTAGACTTAGCATTTGGAAGAAAAACT
ATAAATTAATAAATTGCAGATGGAAATCATATGTCTAGATACTCCGTTAAGGTCAAACAT
GAATTTTTACAAACGATTTGCTGGAAGAGAATGTAACAGTACTATTGGATAGAAGCGCAT
ACATTCTTTAATTTGAATATTGGCACTACAAAGCTTCTAAGTTTTCTTACTATAAGTTAT
GATATTAAGTTTGAGTTGAAGGATTTGTAAAAAGAGCCTTTGGGGGACTTATGCAGCTTT
TTAGGCCCAGACATGCAGTCTGAAGACCCCTTCAAATGGTATGCTATAATCACAGGCCCA
GACGACTCACCTTTTGCTGGTGGGATATTTAAACTACTTATATCGTTCCCAGATGACTAC
CCTTACGACCCTCCTAAAGTGGAATTCGGCACAAAAATCTATCACCCAAATATTTCGAGT
GGAGGAGAAATTTGTTTGGACATTTTGAAATACAGAGATTTGTGGAGTCCTGCTATGACT
ATAGCTAAATTAGTAATGGCAATAATTAGTTTAATGACTGATCCTAATCCAGAAGATCCT
CTATGCCCTGATATTGCAAAAGAATACTTGAGAGATAAAAAGAAATATGCTACGACTGCT
CTAAAATGGACATAACTCTACGCTAGATGA


>Contig13467.0.1.g50(protein)
MDSNVLSFLINYVKNQKEKQQYLKSLIEENKNKHILIDLSDKDDLSLTSNSHNENTHNTQ
QDTKDTTICEKTINFARIDQNQEQNDILKYNTSLTSSTLPQQDQVQTLTSKATPSKKDIQ
KLLKSSEVILNDEAYIESKIIYSARTQKRKGCYSTVKDLWLGQPTNNLSKKLDLAFGRKT
INQQIADGNHMSRYSVKVKHEFLQTICWKRMQQYYWIEAHTFFNLNIGTTKLLSFLTISY
DIKFELKDLQKEPLGDLCSFLGPDMQSEDPFKWYAIITGPDDSPFAGGIFKLLISFPDDY
PYDPPKVEFGTKIYHPNISSGGEICLDILKYRDLWSPAMTIAKLVMAIISLMTDPNPEDP
LCPDIAKEYLRDKKKYATTALKWTQLYAR