Identifiers and Description

Gene Model Identifier

Contig18227.0.g9

Standard Name

UBC1c

Aliases

Contig18227_0_g9

Description

Ubiquitin-conjugating enzyme

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005789904.0017993270483566e-44Ubiquitin-conjugating enzyme f
amily protein
SGDYGR133W9.99723014177113e-33PEX4 SGDID:S000003365, Chr VII
from 756896-757447, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18227.0.g9(coding)
ATGGCTTTAAACAACACCAAGGATATAGATATATTGCTCAATCCAATTAATGATAATCTA
TTTCACTGGTAGGGATTAATCAAGGGACCCCCTGAAACACCATATGAAAGAGGATGGTTC
AAGCTAGATTTCAAGATTGATCAAAACTATCCTATTAATCCACCTAAAGTCAAATTCTTA
ACACGTATTTTTCACCCGAATATACATTTTGAAACAGGAGAGATTTGCTTGGATATCCTA
AAAGCTTAGCACTGGTCTCCAGCATGGACCCTAGAATCCCTATGCCGTGCAATCGTAAAT
CTATTAGTAAATCCTAACGCGGACTCTCCACTTAATTGTGACTCTGGTAACATGATTAGA
GCAGGCGACATGGTCGCATTTAGAACTATGGCTTACATGTACACTGTAGAAAATGCTTGT
GAGGACACTGTGTTCGAGGCAGAAACAGTTTTAATAAGCAGAAAGAAAGTTGAATGA


>Contig18227.0.g9(protein)
MALNNTKDIDILLNPINDNLFHWQGLIKGPPETPYERGWFKLDFKIDQNYPINPPKVKFL
TRIFHPNIHFETGEICLDILKAQHWSPAWTLESLCRAIVNLLVNPNADSPLNCDSGNMIR
AGDMVAFRTMAYMYTVENACEDTVFEAETVLISRKKVE