Identifiers and Description

Gene Model Identifier

Contig4987.0.g18

Standard Name

UBC1b

Aliases

Contig4987_0_g18

Description

Ubiquitin-conjugating enzyme

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYBR082C6.0018831389078936e-89UBC4 SGDID:S000000286, Chr II
from 407027-406628,407169...
T. thermophilaTTHERM_005319004.0007753645635287e-88Ubiquitin-conjugating enzyme f
amily protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig4987.0.g18(coding)
ATGGCCTTGAAGAGAATCTAGAAGGAACTGATCGATCTTGGTAGAGATCCCCCTGCCAAC
TGCTCTGCCGGTCCCATTGATGAGAAAGATCAGTATCACTGGTAAGCTACCATTCTCGGT
CCTGATGACAGTCCATATGCTGGAGGTGTGTTCTTCCTCAACATCCACTTCCCTACAGAC
TACCCATTCAAGCCACCCAAGTGCACATTTACTACCAGAATCTATCATCCCAACATCAAT
TCAAATGGTTCCATCTGCCTAGATATCCTCAAGGATCAGTGGTCACCTGCTCTCACCATC
TCAAAGGTACTTTTGTCAATCAGCTCTTTGTTAACCGATGCCAACCCTGACGATCCATTG
GTTCCAGAAATCGCCCACATCTACAAAACTGATAGACCTAAGTACGAAGCTACCGCCAGA
GAGTGGACCCGCAAGTACGCTATGTGA


>Contig4987.0.g18(protein)
MALKRIQKELIDLGRDPPANCSAGPIDEKDQYHWQATILGPDDSPYAGGVFFLNIHFPTD
YPFKPPKCTFTTRIYHPNINSNGSICLDILKDQWSPALTISKVLLSISSLLTDANPDDPL
VPEIAHIYKTDRPKYEATAREWTRKYAM