Identifiers and Description

Gene Model Identifier

Contig13807.0.g110

Standard Name

UBC1a

Aliases

Contig13807_0_g110

Description

Ubiquitin-conjugating enzyme

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYBR082C2.0006821221283624e-88UBC4 SGDID:S000000286, Chr II
from 407027-406628,407169...
T. thermophilaTTHERM_005319002.9991172563576427e-86Ubiquitin-conjugating enzyme f
amily protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13807.0.g110(coding)
ATGGCCCTCAAGAGAATCCAAAAGGAACTTATTGATTTGGGAAGAGACCCACCTGCCAAC
TGCTCAGCCGGCCCAGTCAACGAGAACGATCAATATCACTGGTAAGCTACCATCATGGGA
CCAGATGATAGCCCATATGCTGGCGGTGTGTACTTCTTGAACATCCACTTCCCCACTGAT
TACCCCTTCAAGCCACCTAAGTGCAGTTTCACTACTAGAATCTATCACCCCAACATTAAC
TCCAATGGAGCTATTTGCTTGGATATATTGAAGGATCAGTGGTCACCAGCACTCACCATC
TCCAAGGTTTTGCTCTCAATCAGTTCTTTGTTGAATGATGCCAACCCAGATGATCCCTTG
GTGCCAGAAATTGCTCATATCTACAAGACCGACAAGCCCAAGTATGAAGCAACAGCCAGA
GAATGGACCAGAAAATACGCTATGTGA


>Contig13807.0.g110(protein)
MALKRIQKELIDLGRDPPANCSAGPVNENDQYHWQATIMGPDDSPYAGGVYFLNIHFPTD
YPFKPPKCSFTTRIYHPNINSNGAICLDILKDQWSPALTISKVLLSISSLLNDANPDDPL
VPEIAHIYKTDKPKYEATAREWTRKYAM