Identifiers and Description

Gene Model Identifier

Contig22503.0.g12

Standard Name

UBC1Le

Aliases

Contig22503_0_g12

Description

Ubiquitin family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYKR094C2.998577119979921e-31RPL40B SGDID:S000001802, Chr X
I from 618374-617996,6187...
T. thermophilaTTHERM_003465502.9998215087698487e-30Ubiquitin family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22503.0.g12(coding)
ATGCTCATTAAAGTCAAAGTGCTTACCGGAAAATTCATTGATATCTCATGCAACTCCTAT
GACACAATCGAAACAGTAAAAGGCTATGTCCAAGATAAAGAGGGCATCCCTCCCGATCAA
TAAAGATTAATCTTCAATGGCAAATAACTTGAAGACAATAGAACTCTTAGCTAATACAAT
ATTCAAGAAGGAAATGAACTCCACCTCGTTCTTAGACTAAGAGGAGGATGA


>Contig22503.0.g12(protein)
MLIKVKVLTGKFIDISCNSYDTIETVKGYVQDKEGIPPDQQRLIFNGKQLEDNRTLSQYN
IQEGNELHLVLRLRGG