Identifiers and Description

Gene Model Identifier

Contig8023.0.g94

Standard Name

UBC1Ld

Aliases

Contig8023_0_g94

Description

Ubiquitin family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000772409.997093137033517e-262Ubiquitin family protein
SGDYLL039C9.997093137033517e-262UBI4 SGDID:S000003962, Chr XII
from 65207-64062, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig8023.0.g94(coding)
ATGCAAATCTTCGTTAAGACCCTCACAGGCAAGACCATCACTTTGGACGTTGAGCCCTCT
GACACCATCGAAAATGTCAAGGCCAAGATCCAAGACAAGGAAGGAATCCCACCCGATCAA
CAAAGACTCATCTTCGCTGGCAAGCAACTCGAAGACGGAAGAACCTTGTCCGACTACAAC
ATCCAGAAGGAATCAACCCTTCACTTGGTTCTCAGACTCAGAGGAGGTATGCAAATCTTC
GTGAAGACCCTCACTGGAAAGACCATCACTCTTGATGTTGAGCCATCAGACACTATTGAA
AACGTCAAGGCCAAGATCCAAGATAAGGAAGGTATTCCCCCCGATCAACAAAGACTCATT
TTTGCTGGAAAGCAACTTGAAGATGGAAGAACCCTTAGTGACTACAACATCCAAAAGGAG
TCAACCCTTCACTTGGTCCTCAGATTGAGAGGTGGTATGCAAATCTTCGTCAAGACCCTT
ACCGGAAAGACCATCACCTTGGACGTCGAGCCTTCAGATACCATTGAGAATGTCAAGGCA
AAGATCCAAGACAAGGAAGGTATCCCACCCGATCAACAAAGACTCATTTTTGCTGGAAAG
CAACTTGAAGATGGAAGAACCCTTAGTGACTACAACATCCAAAAGGAGTCAACCCTTCAC
TTGGTCCTCAGATTGAGAGGTGGTATGCAAATCTTCGTCAAGACCCTTACCGGAAAGACC
ATCACCTTGGACGTCGAGCCTTCAGATACCATTGAGAATGTCAAGGCAAAGATCCAAGAC
AAGGAAGGTATCCCACCCGATCAACAAAGACTCATCTTCGCCGGAAAGCAACTTGAAGAT
GGCAGAACTCTTTCAGACTACACATCCAGAAAGATCTACTCTTCATTTGGTCCTCAGACT
CAGAGGTGGTATGCAATCTTCGTCAAGACCCTCACCGGAAAGACCATCACCCTCGATGTT
GAGCCATCAGACACCATTGAAAACGTGAAGGCCAAGATCTAGGACAAGGAAGGTATCCCA
CCCGATCAACAAAGACTTATCTTCGCTGGTAAGCAACTTGAAGACGGCAGAACCTTGTCC
GACTACAACATCCAAAAGGAGTCAACTCTCCACTTGGTCCTCAGACTTAGAGGTGGTTGA


>Contig8023.0.g94(protein)
MQIFVKTLTGKTITLDVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLDVEPSDTIENVKAKIQDKEGIPPDQQRLI
FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLDVEPSDTIENVKA
KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
ITLDVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYTSRKIYSSFGPQT
QRWYAIFVKTLTGKTITLDVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLS
DYNIQKESTLHLVLRLRGG