Identifiers and Description

Gene Model Identifier

Contig1397.1.g71

Standard Name

UBC1Lb

Aliases

Contig1397_1_g71

Description

Ubiquitin family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam00240 ) Ubiquitin family
  • ( pfam11976 ) Ubiquitin-2 like Rad60 SUMO-like
  • ( pfam13019 ) Telomere stability and silencing
  • ( pfam13881 ) Ubiquitin-2 like Rad60 SUMO-like
  • ( pfam10302 ) DUF2407 ubiquitin-like domain
  • ( pfam11470 ) GLUT4 regulating protein TUG
  • ( pfam11069 ) Protein of unknown function (DUF2870)
  • ( pfam13860 ) FlgD Ig-like domain
  • ( pfam09379 ) FERM N-terminal domain
  • ( pfam03587 ) EMG1/NEP1 methyltransferase
  • ( pfam01556 ) DnaJ C terminal domain
  • ( pfam10787 ) Uncharacterised protein from bacillus cereus group
  • ( pfam11620 ) GA-binding protein alpha chain
  • ( pfam11188 ) Protein of unknown function (DUF2975)
  • ( pfam08337 ) Plexin cytoplasmic RasGAP domain
  • ( pfam12636 ) Protein of unknown function (DUF3781)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003464909.997093137033517e-262Ubiquitin family protein
SGDYLL039C9.997093137033517e-262UBI4 SGDID:S000003962, Chr XII
from 65207-64062, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1397.1.g71(coding)
ATGCAAATCTTCGTTAAGACCCTCACAGGCAAGACCATCACTTTGGACGTTGAGCCCTCT
GACACCATCGAAAATGTCAAGGCCAAGATCCAAGACAAGGAAGGAATCCCACCCGATCAA
CAAAGACTCATCTTCGCTGGCAAGCAACTCGAAGACGGAAGAACCTTGTCCGACTACAAC
ATCCAGAAGGAATCAACCCTTCACTTGGTTCTCAGACTCAGAGGAGGTATGCAAATCTTC
GTGAAGACCCTCACTGGAAAGACCATCACTCTTGATGTTGAGCCATCAGACACTATTGAA
AACGTCAAGGCCAAGATCCAAGATAAGGAAGGTATTCCCCCCGATCAACAAAGACTCATT
TTTGCTGGAAAGCAACTTGAAGATGGAAGAACCCTTAGTGACTACAACATCCAAAAGGAG
TCAACCCTTCACTTGGTCCTCAGATTGAGAGGTGGTATGCAAATCTTCGTCAAGACCCTT
ACCGGAAAGACCATCACCTTGGACGTCGAGCCTTCAGATACCATTGAGAATGTCAAGGCA
AAGATCCAAGACAAGGAAGGTATCCCACCCGATCAACAAAGACTCATCTTCGCCGGAAAG
CAACTTGAAGATGGCAGAACTCTTTCAGACTACAACATCCAGAAAGAATCTACTCTTCAT
TTGGTCCTCAGACTCAGAGGTGGTATGCAAATCTTCGTCAAGACCCTCACCGGAAAGACC
ATCACCCTCGATGTTGAGCCATCAGACACCATTGAAAACGTGAAGGCCAAGATCTAGGAC
AAGGAAGGTATCCCACCCGATCAACAAAGACTTATCTTCGCTGGTAAGCAACTTGAAGAC
GGCAGAACCTTGTCCGACTACAACATCCAAAAGGAGTCAACTCTCCACTTGGTCCTCAGA
CTTAGAGGTGGTTGA


>Contig1397.1.g71(protein)
MQIFVKTLTGKTITLDVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLDVEPSDTIENVKAKIQDKEGIPPDQQRLI
FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLDVEPSDTIENVKA
KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
ITLDVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR
LRGG