Identifiers and Description

Gene Model Identifier

Contig148.1.g13

Standard Name

UBC1La

Aliases

Contig148_1_g13

Description

Ubiquitin family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003465401.0000297864968827e-159Ubiquitin family protein
SGDYLL039C9.999341372639941e-153UBI4 SGDID:S000003962, Chr XII
from 65207-64062, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig148.1.g13(coding)
ATGTAAATTTTCGTTAAGACTCTCACTGGCAAGACCATCACTCTTGATGTTGAGCCATCA
GATACCATTGAAAATGTCAAGGCTAAGATCCAAGACAAAGAGGGAATCCCACCCGATCAA
CAGAGACTCATTTTCGCTGGAAAACAGTTGGAAGACGGCAGAACCCTCTCCGACTACAAC
ATCCAGAAGGAGTCAACCCTTCACTTGGTCTTGAGACTCAGAGGAGGTATGCAAATCTTC
GTTAAGACCCTTACCGGAAAGACCATCACCCTTGACGTCGAGCCATCAGACACTATTGAA
AACGTTAAGGCAAAGATCCAAGATAAAGAAGGTATCCCACCCGATCAACAGAGACTTATC
TTCGCCGGCAAGCAACTTGAAGATGGAAGAACCCTTTCAGACTACAATATTCAAAAAGAA
TCTACCCTTCACTTGGTTCTCAGATTGAGAGGAGGTATGTAGATCTTCGTGAAAACCTTG
ACCGGTAAGACTATCACTTTGGACGTCGAACCATCCGACACCATCGAGAATGTCAAAGCC
AAGATCCAGGACAAGGAAGGTATTCCACCCGATCAACAAAGACTCATCTTCGCCGGTAAA
CAACTTGAAGACGGCAGAACTTTGAGCGACTACAACATCCAAAAGGAGTCTACTCTCCAC
TTGGTCCTCAGACTTAGAGGTGGTCAATGA


>Contig148.1.g13(protein)
MQIFVKTLTGKTITLDVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLDVEPSDTIENVKAKIQDKEGIPPDQQRLI
FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLDVEPSDTIENVKA
KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGQ