Identifiers and Description

Gene Model Identifier

Contig11774.0.g83

Standard Name

UBA52d

Aliases

Contig11774_0_g83

Description

Ubiquitin family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYKR094C3.0007793728221555e-22RPL40B SGDID:S000001802, Chr X
I from 618374-617996,6187...
T. thermophilaTTHERM_003465606.9997332827772725e-22Ubiquitin family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11774.0.g83(coding)
ATGCAACTTCTCATTAAAACCTTAACCGGCAGAAAGCAGTCGTTTAACTTCGACCCCGAC
AACACCATCCTCCAGGTCAAGCAGGCATTGCAAGAGAAAGAGGGCATCATGATTGATCAA
ATCAGACTAATCTTTGGAGGCAAGCAGCTTGCTGATGAGATGAAGATATCCGACTACAAT
CTTGAGGCTGGCAGCACTATCCACATGGTCCTTCAACTCAGAGGTGGATACTGA


>Contig11774.0.g83(protein)
MQLLIKTLTGRKQSFNFDPDNTILQVKQALQEKEGIMIDQIRLIFGGKQLADEMKISDYN
LEAGSTIHMVLQLRGGY