Identifiers and Description

Gene Model Identifier

Contig12690.0.g68

Standard Name

UBA52a

Aliases

Contig12690_0_g68

Description

Ubiquitin family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003396203.0013199058937152e-77Ribosomal L40e family protein
SGDYKR094C6.996899116468003e-76RPL40B SGDID:S000001802, Chr X
I from 618374-617996,6187...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12690.0.g68(coding)
ATGTAGATCTTCGTCAAGACTTTGACCGGTAAGACTATTACTCTTGATGTAGAGCCTTCT
GATACCATCGAAAACGTTAAGGCCAAGATTCAAGACAAAGAAGGTATTCCCCCTGATCAA
CAGAGACTCATCTTTGCTGGAAAGTAGTTGGAAGACGGCAGAACCTTGTCTGATTACAAC
ATCCAAAAAGAATCAACTCTCCACTTGGTCTTGAGACTTAGAGGTGGTGGTCAAGGTTCC
ATCCAAATTGAACCATCACTTGCTGCCCTCGCAAGAAAGTACAGATGCGACAAGATGATC
TGCAGAAAGTGCTACGCTACTCTCCCACCAAAGGCAACCAACTGCAGAAAGAGAAAGTGC
GGTCACAACAGTGATCTCAGACTCAAGAAGAAGCTAAAGGGCTGA


>Contig12690.0.g68(protein)
MQIFVKTLTGKTITLDVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGGQGSIQIEPSLAALARKYRCDKMICRKCYATLPPKATNCRKRKC
GHNSDLRLKKKLKG