Identifiers and Description

Gene Model Identifier

Contig20101.0.g96

Standard Name

UBA2

Aliases

Contig20101_0_g96

Description

ThiF family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000928403.9997119520108244e-79hypothetical protein
SGDYDR390C6.997125142158947e-47UBA2 SGDID:S000002798, Chr IV
from 1256847-1254937, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20101.0.g96(coding)
ATGAGTGTAATTAAACAAGCAAAGTTAGAGTTGATCTATGGCAAAGAAACAGCTGCTAAA
ATCATAAATTCTAATGTATTAGTAGTAGGTGCTGGAGGAATAGGATGTGAGCTCATGAAA
ACTCTATCTGTAACCGGCTTTATTAAGATAACAATTATCGATCTCGATACTATCGATGTT
AGCAACTTGAACAGATAGTTCCTCTTCAGGAGAGAACATGTTGATATGTCCAAAGCCCAA
GTTCTCAGAGACCAGATACAGAAGCAAAATCCACACATTCAAATTTAACATTACATCGGT
AGAATTTAAGAGGAGAGGTTCGGATATAAGTTCTTCATTCAATTTGACATCGTGATTAAT
GCACTTGACAACATTGAAGCTAGAAACCATGTGAATCAGATGTGCTTCAACCTCAATATT
CCACTTGTTGAAGCTGGTACTAATGGTTATGATGCCACTTGTATTTCAATGGCAAAGAAT
CAAACTCCATGTTACCAATGTGTTGACTAAGTAAAAGACTAAGCTTTTCCTGTGTGTACT
ATCAGACAAAAGCCAGAAAAGTTGATTCACTGCATTATCTGGGCAAAGTTTCTATTCGAA
GGACTTTTTGGACCTAAGAACCAATCAGAGGACTATGTATCTGAAGAGATGAACAATCTC
AAGCCTTTAAATTCTTCAGTGAACGACCAAAAGAATAAACTAGTAGATCATGCAGGGCCA
ACTTCATAAACTACAATTGATAATTTGCTTTTACATGCGATTGATATCTTCACCAAGGTT
TTCGACATAGAGGTTGAAAGTCAAGTATCAAAACTCAAACTTAAGATTACTTCGGCTTAG
AGCAACCTTAACTTACACGAGAAAGAAAGTGAAGAGCAGTTTCTTATGAAAGTTAAATCA
CTGAAATTTGAGCATTATATGGAATTTATCAAGAAAAGTTTGTCTGATTAAGACTATAAG
CTGAACAACAGGGAACTTTATGACGAAAACATGATTATTGTGTTGAGTTTGCAAGAGTAG
ATCTATACCTTTATCAAGAGCATCATTAGTATCTATGAAAATAGACAGTAATTAGTGGGA
ACCATGGTATTTGACAAAGATGATGAGCTGATTATTGATTTTGTTTCAGCTGCAACAAAT
CTTAGAGCTTACAACTTCTCAATTAATATGGAGAGTAAGTTCAAGATTAAGGAAATGGCT
GGCAAGATCATTCCAGCAATTTCAAGTTCAAATGCCTTAGTGGCTAACCTGCAAGTCTTT
GAAGCTGTGAAACTTCTATCCAAGGAATTTGAGAAATTGCGTGGTATATACTACAGAAGG
CAAGATCCTAAGAGACTCCAAAGCTACAGAAGACTCAATGATGAAAGAAATCCAAATTGT
AAAGTATGTTCGAATGATCACTAACACATCTACTTTGTGGAGATCAAAAGTTTATAAGAG
TTTACTTTTGGAGAATTCATTCAGAAAGTGCTGGTGCAGGATATCAAACTAGATGAAGAA
ATTCAAATTGACTATAACAACAAGATTGTTTATGACTACTATGAAGACTGTGATGATTTC
TAAGAAAAGCAAAACAAAGCTAATGTCTTGAAAACCTTTGAGCAGCTCGACATAAAAGAC
TGCAGTGTGATATCAGTGTAAGCTGCTTTCTTGTAGGATCCTGATGGTGTAGAAGGGCAG
ACTCATACTTTCATGATTCAAGTGATGAGTGGACTAAACTTGAACTAGTCCAGCATTGAC
AGTGATTAAGCTCTTACACATTTGACTCATAAGATCAAGTAAGGTGTGAGAAAGTCTCAA
GCAGTGATTGATGCAAATGCAGCAAAATTGAAAGAAATTCAATAACTGAAGAAAGCAGCT
CTTGCTAAGGATGGTAACTCACTTGTGATCTCTGATGATGAACTCGAGATGGATGATCAA
CCTCTGCCTACCAATTCTTTAACTGCTTACAAGCAGGCTCGCAATTCAAATCAGTCAAGA
GTGAGCGAGTAAAATCCATACTCAGCCAGGGTTTCCTCTGCCATGCAACAGATTGAGGAC
AGAAGTGAAACTTAACTTCAAACTGAAGCTCAAAACGATGGAAATCTACTGGGAAGAAGA
TCTCAAAGATAGGAAGATATTGAAATGCTTGAAGATGCAAAAAGCGATACTCAGAAAACA
GTTGAGCGATCCTCATCAGCTGTTGGAGGAAATGAAAATGGTAATGTTGGTGATGGAGAG
TAGATAGATGTTGACAGCATAAAACAATTGGAAAGCCCTTCAAAGAGACAAAGAATTGAA
TGA


>Contig20101.0.g96(protein)
MSVIKQAKLELIYGKETAAKIINSNVLVVGAGGIGCELMKTLSVTGFIKITIIDLDTIDV
SNLNRQFLFRREHVDMSKAQVLRDQIQKQNPHIQIQHYIGRIQEERFGYKFFIQFDIVIN
ALDNIEARNHVNQMCFNLNIPLVEAGTNGYDATCISMAKNQTPCYQCVDQVKDQAFPVCT
IRQKPEKLIHCIIWAKFLFEGLFGPKNQSEDYVSEEMNNLKPLNSSVNDQKNKLVDHAGP
TSQTTIDNLLLHAIDIFTKVFDIEVESQVSKLKLKITSAQSNLNLHEKESEEQFLMKVKS
LKFEHYMEFIKKSLSDQDYKLNNRELYDENMIIVLSLQEQIYTFIKSIISIYENRQQLVG
TMVFDKDDELIIDFVSAATNLRAYNFSINMESKFKIKEMAGKIIPAISSSNALVANLQVF
EAVKLLSKEFEKLRGIYYRRQDPKRLQSYRRLNDERNPNCKVCSNDHQHIYFVEIKSLQE
FTFGEFIQKVLVQDIKLDEEIQIDYNNKIVYDYYEDCDDFQEKQNKANVLKTFEQLDIKD
CSVISVQAAFLQDPDGVEGQTHTFMIQVMSGLNLNQSSIDSDQALTHLTHKIKQGVRKSQ
AVIDANAAKLKEIQQLKKAALAKDGNSLVISDDELEMDDQPLPTNSLTAYKQARNSNQSR
VSEQNPYSARVSSAMQQIEDRSETQLQTEAQNDGNLLGRRSQRQEDIEMLEDAKSDTQKT
VERSSSAVGGNENGNVGDGEQIDVDSIKQLESPSKRQRIE