Identifiers and Description

Gene Model Identifier

Contig18137.0.g68

Standard Name

U2SURP

Aliases

Contig18137_0_g68

Description

RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam00076 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam14259 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam13893 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam01805 ) Surp module
  • ( pfam04818 ) RNA polymerase II-binding domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004312101.9991095569230066e-20Ubiquitin interaction motif fa
mily protein
SGDYBR212W0.00000019998969434520019NGR1 SGDID:S000000416, Chr II
from 647886-649904, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18137.0.g68(coding)
ATGCAAGGTTACATGCCTTATGGACCAACTAATCCCTTGTTAACTCAGGGTCAAAATGCT
AGAGCTTATCATGCTATGGCTGGTTCTAAAAAGAAAAAGGCAATTGATTAGAGTTTGATG
GAGCTTAAGAAAAAGTTTAACATCACTTCAGATGACCACAATGAGGATGAAGGAAGAAGT
TTATTGGGAAAGAGAGATAGAATTCAAAGTTTCGGAAACAAAGCAACAGGAAATTTTGAA
GCTAATCCAAGGATCATGGGCTAAAAACGATTCAGTGATACAGCAGGTGGATTCTCAGAC
AAGTAATAAAGCCAGCCATAGAAAAGTTTTAATCCACTTGAGATAAGTCAAATCGTTGCA
GACAATGCCGACTATTTAATGCAGTAAGTCACTAATATTTATGTTGGGAACTTATCATCC
GAGGTTACCGAGGAAACATTAGCGAAAGTTTTCTGCAAATTTGGGGAGATTGAATCTGTT
AAAATTATGCTTCCAAGAAATGAAGAGGATCGTAAGAAAAAACGCAATTGTGGATTCATT
AAATTTTACAAGTATGAATCAGCATTCTTGGCAAAAGAAGCGATGAACGAGCATCTCCTT
GATGGAATGTCAATGAGAATCAACTGGGGTAAAGGTATTAATTCTATCATTAGAAACAAT
GGACTCCTGGTGGATTATTAAGGGGTTGTCGGGGACTAAGATCTTGAGATGCAATATGTA
GAAAATCAACTAAATCTCATTATAATGGGACATGAATTACTTCAGGATGATTCCATTTTA
GAGTCAGAGTATAATTATTTTCCATAGCACTTGCAAAGAATTCATGTTAAAATTCCTGAA
GATTGTCTTACTAGATATCAGATTGACAAATTCGCCAAATTTATTGCAAAGGAAGGTTTC
TAGTTTGAAGAGGAAATAAAGTATCATATTTCTAAAGGCAAGAACCTTGAAAATCAAATT
ATCAAATAAATTATACTCAAAGAGGATGAAGAACTATCGAACTACTATTAATGGAGATCT
TATTCTTATTTCAATGGAGACTCAACACATTCATGGAGCTAGCATCCATTCCAACTTTAC
CAAAATGGTCCTATTTGGATACCCCCTAGAAACAAAAGTGACTCAATGAGATTAAACCCT
GCTTAAGCAATCAAAGAGAAAATGTTAAAATAAACCAAGCATTTAAAAAGCGCTATTGAA
TAAATAACTCATGGTAACGATGATGAAGAGGATTAAGAAATGCAAAATGTCGACGATTTA
GACGAGCAATTAAAGAAATAAAAAGAACAGTAAGGCTTCATTCCTCTAGGTGAATCGGAT
AGACTGATTATAGAGACATTTATTGCTAATATCAAGTCAACTAAGCGATAAATATGTGAA
GGCATGATCATGGCAATGGAATATGCTTAAAATGCAAGGGATATTGCTGAGCTTTTAACT
TCAGCTATTATTAGCTAGATTGAGGAAACTAGTAAAGAATTGGATATCAAGAGCATTTTC
GCAAAGATTTTCTTAATTTCAGATATATTACACAATAGTTCCAACCCACAAATATCTGCT
GCTTGGACTTATAGACGTGAATTTGAATAAAGATTGAGCAATGTTTTTGATAGTTTGAAT
AAGTTGTGGAGAGTTAAAATTGAGGGAAAACTTAGTTAGAAGCAAGTAAAGAAATAATCA
ATGAGATTGCTCAAGATATGGCGAGACAATAACATTTATGAAGCAAGAGTTATTGAAGGG
TGGGAAGCAACCCTCAAAATAGACAAATCCCAATTTTATTCTTTCAACTTAACTGATGGC
GAGTTTCAACCATCAGACATAAAAGATAAGAAAATCTTAGACAAAATGAAGTAAATTGTT
CTTCCTGAACTTCGAGCTTATTATCGAAGATTAAAGGAGACCAATCAATCCTAGCCAGGA
GTCCTTGAAAGAGAATGTAAACTCAGTGGGGTGCCTCTTTCTACTAACACCACTGATTTG
ATAGAAAGACTAGTTGCACTTCAAGAATACAAAATCAGGAAAGTTTTGAAATCTAAGTTG
AGATCCGAGTTGCAGACATTAGATGAGCACTCCAATAAGGATATCCAAATGACTTAATAC
CTTCATTAAACTATAAGAAAACCCTTAAATGTGCTTGATGATACTTTGAAGGAAGACTCT
CTTCTTAATTAAGAACAAAGAAAGTCAATTGTAGATAAAGCAATACAAGATATCATTTAA
GATATCGTCAAGATAAGAAGTACCTATCTAAAGATTCAATAATCTCTCATGCAAATTGAC
GAAAAATCCATTGATGGGAAAGAGATTTAGGATTTTGAATTGAATTTATTTGAAATTAAT
AGCAAGAATTTAGAGAGAAACGAGAAATTAATCGCAATCGCACAGAGAGCACTGGAGAAA
GGGAGTGGATAAATTGATTTAGACAATTTAAGTCTGGACTCTGACGAATTAATTACTACT
TAAGAGGATATATAAGACAATGAGGACATTGATGGAGTTGAACTTTCAGACAGTGATGAA
ATCTTCTAGAAAAATACAGAGAAAGAAGATACTTTTAGTGCTATTATATCAAGTGATCAC
CTCAAGTAAATACTGAAATATGCTAGATAAAAAAGACTGTTAATGAATAAAAGGCAACAC
TTGAAGTCATAGACTAGTGGTAACAAACATTTAGATCAGGAACTCCTTAGTGCAACTGAA
TAATTAGACAATCAGCGACTCTAGTACAATAGAGCTTTCGAGAAACTCGAAGAAAAAGAT
TTAGCATACCAGAGACTCATAAGATTCAAGCGTAGACTAGAAAAAGATTTCGAGCAATTC
GAGCTAAACCTGTACAATTCCAAGAACAGATACAACGATTTCGAGAAATAACTTAAACTA
ACAAAGGAAAAGCTAAATATGTACAGACTTCTCAATGAAAGATTCAAGTAAGAGGAGATT
GAAAAGAAAACGAAAGAATTTCAACAATCATCATCTTAAGCTTTACAAACTTAGGACTAG
AAAAAGAGCAATTCTGTGAAGGTTTAGGATTTGAGAGGGTAGCCTGCAAAGAATAAATAA
AAAAGACGATAGAAAAGTAATTCCAGCAGCAATTCAGATTCAAGTAGTTCCTTGGAAAAC
TCAGATAGCTCTAAAAGTAGCAAATCAGTATCCTCTAAAAATAATATAAAAAGACAGAAT
GGAAGTAGAGATAGAAGTTATAAGAGGGAAGCAAGGAATGATAAAGATTCAAAGTAAAAG
GGTAATTCATATAGTAAAAAAGAAATTTCTAAAGATGAGAGAAAATATAGAAGATCCAGG
TCAAGAGATAGAGATTACTAAGAAAGGAGAGCAAGAGCAACTTCAGATATAAGATAAGAT
TAAAGGGTGGTAAATCGCAGTGAATCATAGCAACACAAAAATATGACGCTAAGAGATGAG
TCTTAGAGAAGAAGATCACGGTCAAGAGATTAAGATTCAATGAGTAAAAGTGCACAAAGC
AAAGAAATAAAGTTAATAAAACTTGACTCAGATAAAAATGATTCTGCTTAAAAAGCTCAA
GCCGATGATAAAGCTTAAAAGAGTATATTTGAAAGAATCACTTTGAATCCAGCAAGAAAT
TAGGATTAAATAATAGACTAAAATGCAATTTAAATGAGTAGTGATAATAGCGGTAGATTG
AACTTTGAACTCAAGCCACAAAGTTCAAATGACTTGAGTTAAAACTCTTAAAGATAAAAT
TAACAAGATAGTAGAGGTGGAAAAAGGTTTGACAACAATAGAAATTCCAGATTTAGTTGA


>Contig18137.0.g68(protein)
MQGYMPYGPTNPLLTQGQNARAYHAMAGSKKKKAIDQSLMELKKKFNITSDDHNEDEGRS
LLGKRDRIQSFGNKATGNFEANPRIMGQKRFSDTAGGFSDKQQSQPQKSFNPLEISQIVA
DNADYLMQQVTNIYVGNLSSEVTEETLAKVFCKFGEIESVKIMLPRNEEDRKKKRNCGFI
KFYKYESAFLAKEAMNEHLLDGMSMRINWGKGINSIIRNNGLLVDYQGVVGDQDLEMQYV
ENQLNLIIMGHELLQDDSILESEYNYFPQHLQRIHVKIPEDCLTRYQIDKFAKFIAKEGF
QFEEEIKYHISKGKNLENQIIKQIILKEDEELSNYYQWRSYSYFNGDSTHSWSQHPFQLY
QNGPIWIPPRNKSDSMRLNPAQAIKEKMLKQTKHLKSAIEQITHGNDDEEDQEMQNVDDL
DEQLKKQKEQQGFIPLGESDRLIIETFIANIKSTKRQICEGMIMAMEYAQNARDIAELLT
SAIISQIEETSKELDIKSIFAKIFLISDILHNSSNPQISAAWTYRREFEQRLSNVFDSLN
KLWRVKIEGKLSQKQVKKQSMRLLKIWRDNNIYEARVIEGWEATLKIDKSQFYSFNLTDG
EFQPSDIKDKKILDKMKQIVLPELRAYYRRLKETNQSQPGVLERECKLSGVPLSTNTTDL
IERLVALQEYKIRKVLKSKLRSELQTLDEHSNKDIQMTQYLHQTIRKPLNVLDDTLKEDS
LLNQEQRKSIVDKAIQDIIQDIVKIRSTYLKIQQSLMQIDEKSIDGKEIQDFELNLFEIN
SKNLERNEKLIAIAQRALEKGSGQIDLDNLSLDSDELITTQEDIQDNEDIDGVELSDSDE
IFQKNTEKEDTFSAIISSDHLKQILKYARQKRLLMNKRQHLKSQTSGNKHLDQELLSATE
QLDNQRLQYNRAFEKLEEKDLAYQRLIRFKRRLEKDFEQFELNLYNSKNRYNDFEKQLKL
TKEKLNMYRLLNERFKQEEIEKKTKEFQQSSSQALQTQDQKKSNSVKVQDLRGQPAKNKQ
KRRQKSNSSSNSDSSSSLENSDSSKSSKSVSSKNNIKRQNGSRDRSYKREARNDKDSKQK
GNSYSKKEISKDERKYRRSRSRDRDYQERRARATSDIRQDQRVVNRSESQQHKNMTLRDE
SQRRRSRSRDQDSMSKSAQSKEIKLIKLDSDKNDSAQKAQADDKAQKSIFERITLNPARN
QDQIIDQNAIQMSSDNSGRLNFELKPQSSNDLSQNSQRQNQQDSRGGKRFDNNRNSRFS