Identifiers and Description

Gene Model Identifier

Contig1218.1.g100

Standard Name

U2AF2b

Aliases

Contig1218_1_g100

Description

RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00076 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam14259 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam13893 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam08648 ) Protein of unknown function (DUF1777)
  • ( pfam08702 ) Fibrinogen alpha/beta chain family

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001512108.002420766648515e-44hypothetical protein
SGDYIR005W0.00000008001913847069386IST3 SGDID:S000001444, Chr IX
from 364889-365335, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1218.1.g100(coding)
ATGGGAGGAGACAAAAAGAGAGATAGAAAGAGGTCAAGATCATCAAGAGACGCCAGTAAG
AGCAGTAGAGATAGAAAGAGAGATCGGGATTCTAGAAGCAGAGAGCGAAGCAGAAGAGAT
GCTTCAAATAAAAAATCAAGTAGATCTAGAGACAGGAAAGAAGAGTCCAATTCAAAAAGA
CGATCCAGATTTGATCTTGGTACAACTCAATCATCAACAAGCGGTTTCTCAATAAATCAT
TAATAGCCATTGGACCTAAATTTACACTTCAACGCATCAGCTTAGCCTATGACAGTTTCT
CAGCAACTTTAATTGAATCAAACTCTCAGCAATTCAAGTGGGATAAGTACAGGGAGAATA
TCAAGTGGGATAAGTGGTTTGAAACTAAATAACTCAGCATCTATGGCTATCTAATAGTTT
AAGAATAATCAGCAGAATTGTACTAATTTGGGGTTGGGTTTGAGCATAAATTTAGGCAAT
GGAGTTACCATAGGTGGGGGAGGTTCAGCATCCATCTCTAGTAATCCTTCCTATTAAGCT
TCATAGATAGGAACTGACATACATTCCCGCAGATTATATGTAGGAGGTGTTCCAACAAGT
CAATCTGACGTTTAAGTAGTGCAATTTCTGACCTAAACCCTAAGAAAAGCTGGAGGCATC
TTAGAGGAGGGTGACCCAGTAATCAAATCCCAAAATAACCCAGAGAAGAGATACACATTC
TTGGAGCTAAGGTCTGTAGAAGAAGCAAGCACTATGATATAGCTTGATGGAATAAAGTTC
ATGGACTCTACTTTGAGGATAAGACGTCCAGAAGATTACGATAAATACCCCTAAATACCA
CCTAGGAGACCTATCCCTTAAATTGATACAGCAGCTCTTGGCATTATAAGTACCAAGGTA
GAGGAAACTCCTTTAAAGATATTCGTTGGTGGTCTGCCCAAAGAATTCAACGAAGAATAA
ATAAAGAATTTACTGCTTAGATATGGCTAATTAAAGAGTTTCCATTTAGTCAAGCACACT
AACATTGACCAATCACGTGGTTTCGCATTTTGTGAGTATACTGATGAAAAGGGAGTGTAA
AACGCAATTTAATTCTTAAATGGCTTGAAAATAGGCAGTAGAAGCATAAATGTGAGAAGA
ACTGGGGCTAGCACAAGTACTGTACAATAAAATCAAATTAGCGAGGAAGATAAGAAAAAG
TTCGAAGATAAACTTGACGATTTTATTAATGAGACTGGCAAGTTCATGTAGAATGCGAAT
ATGTACAACATAGACAAGTAGTCTGTATAACAGCATAATCCATTTGATGAACTAGAAAGG
CACAATTAATAAATGGCTTCATACATCCAGCAATCCTATGGCTACACCACTATTTCAACA
GTAATGGAGATAAAAATACCAGCTTTATCACAATAAATCTTAGACAACGACTAGGAGCAC
GATGAGCTAGTGAAGGATTTAACCTAGGAATTGTAGAAATTTGGAAAAATAAGAACTTTA
TTGCTGCCTCGCTCACTTGATATGATGTAAACTTCGACTGTTAAGCCATCTGCTATTGGG
AAGGCTTTTGTGGAATTTGAAGAAGTAACCAGTGGCTTTGCTTGTTACAATTTACTTAAT
GGAAGGCAATTTATGGGGATGCCAGTGGAAATTAACTTTTATAATAAAGATCTGTTTGTT
ACTAAGTCACTCATGTGA


>Contig1218.1.g100(protein)
MGGDKKRDRKRSRSSRDASKSSRDRKRDRDSRSRERSRRDASNKKSSRSRDRKEESNSKR
RSRFDLGTTQSSTSGFSINHQQPLDLNLHFNASAQPMTVSQQLQLNQTLSNSSGISTGRI
SSGISGLKLNNSASMAIQQFKNNQQNCTNLGLGLSINLGNGVTIGGGGSASISSNPSYQA
SQIGTDIHSRRLYVGGVPTSQSDVQVVQFLTQTLRKAGGILEEGDPVIKSQNNPEKRYTF
LELRSVEEASTMIQLDGIKFMDSTLRIRRPEDYDKYPQIPPRRPIPQIDTAALGIISTKV
EETPLKIFVGGLPKEFNEEQIKNLLLRYGQLKSFHLVKHTNIDQSRGFAFCEYTDEKGVQ
NAIQFLNGLKIGSRSINVRRTGASTSTVQQNQISEEDKKKFEDKLDDFINETGKFMQNAN
MYNIDKQSVQQHNPFDELERHNQQMASYIQQSYGYTTISTVMEIKIPALSQQILDNDQEH
DELVKDLTQELQKFGKIRTLLLPRSLDMMQTSTVKPSAIGKAFVEFEEVTSGFACYNLLN
GRQFMGMPVEINFYNKDLFVTKSLM