Identifiers and Description

Gene Model Identifier

Contig20715.0.g17

Standard Name

U2AF2a

Aliases

Contig20715_0_g17

Description

RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00076 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam14259 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam13893 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005251507.001890014428386e-55U2 snRNP auxilliary factor, sp
licing factor
SGDYGL044C0.000006997203421143941RNA15 SGDID:S000003012, Chr VI
I from 417036-416146, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20715.0.g17(coding)
ATGGGAAGATCAAGAAGCAGAGATAAAAGACGTAGTTCAAGAGATAGAAGTAAGGACAGA
AGCACTAGGAGAGATGATAAGGATTCAAGAAGAAGAAAGGATGACTCCCCTCATAGATCC
CATAGAGATAGAGACGATAAAAAGCACAGATCCAGCAGAGATATAGATAAAGCTAGAGAT
GAATCGAGCAAGAGGAAAGACGATAAGAGAAGAACGAGTGATTCAAGGGAAGGAAGACGA
AGAGATAAAGATCGCAAGGGCAAGAGAGACACTTCAGAAGAGAAAAAGTACAGTAGGAGT
GAAAAGAAGGATCGAAGAAATAAAGATGGAAATATGTCAAGTGATTCACAAAAGTCAAGT
CCTCTGGTCTCATCAAGCAGTAGCAACACACCTGAGAAATACAAAGGAGATGATATTCTA
ATCACTGAGGGATACAAGCTTTATCTTGAACGTAAAAAGCTAAGAAAATAAGAAGAAGAG
AAGAAAGCAGCAGCTCTTTAAGATGGCATGGAAGGAGGCCTGAAACTCAGGAAAGTTGAC
TTAAAAGATTTCCCAAACTACAAAAGAAAGCTAGTTATTCAAAATTTACCCCCTGATATT
ACTGAGGAAGATGTTATGAACTATTTCTTCACAGTTATCTCTTCATTTAGCAAGGTGGAG
TATCAAAAGAACCCAATTATGTCTGTAATTAAGTACAAGGACTTGGGTTTTGTGACTTTG
GAATTCAGAAAACGTGATGAAGGAGAGATATGCTTAACTCTAGATGGTACTGAATATAGG
ACTGGTTATAAGATGCGCATTATGAGAGTAAAAAGATTCATAGATGACTGGAATGCGGAC
ATAGACAAGGGCAAAAATCCTATTGAAGCTATGACTAGAGGGAAAGGGGTATCTCTGTTT
TCTACTGGTAATAATTAGTTCAAGGAGCCTGCTAAACCTGACTAAAAGGCAGGGAAGAAA
GAAAAAGTGGAGGAGGTAGATAATAGACTTTATATGGGAAACATTCCTAATTCTATGAAG
GATGAAGATGTTAAGAAAATGTGTGAATCATTCGGTAGATTAAAGGCATTCAACTTAGTG
AAAGATCCCATGAACCCAGATCTAAACAAAGGCTATGCTTTCTTTGAATATGTAGATGAA
AGATCGATAGATAAAGCAATCAAGTCACTTAATGGTCTAGATTTTAAAGAGAAAAAGTTG
AAAGTATAAAAGGCTAGTGCTCATTAAAAGACATCGTAAACACAGATTCAAATTGGCATG
TACAAGAACGTTCCTGATGAAAAGAGATTACCAATCCCTCTGTTCGCTATGACTCCAAGT
CGTGTGGTCCAATTTATCAATATGATATCAGTCGAAGATCTTTTTGAAGAGGATGAGATT
ATTCATGTAAAAGATGATCTGCTTTAGGAATGCAAAAATTATGGAGAAATTATCAGCATT
GAGATCCCTAAGCCAGACGAGCAGGGACATGCAACTTATGGAGTTGGCAAAATCTTTGTC
AAATTCAATCATATAGTGGCTGCTAAACAAGCTAGATACAAGCTATCTGGAAGAAAATAT
AACGGAAGAACAGTGGTTGTTTCATTTTACCCTGAGCACTACTTCGACATCAAGGAGTTT
TCAATTATATGA


>Contig20715.0.g17(protein)
MGRSRSRDKRRSSRDRSKDRSTRRDDKDSRRRKDDSPHRSHRDRDDKKHRSSRDIDKARD
ESSKRKDDKRRTSDSREGRRRDKDRKGKRDTSEEKKYSRSEKKDRRNKDGNMSSDSQKSS
PLVSSSSSNTPEKYKGDDILITEGYKLYLERKKLRKQEEEKKAAALQDGMEGGLKLRKVD
LKDFPNYKRKLVIQNLPPDITEEDVMNYFFTVISSFSKVEYQKNPIMSVIKYKDLGFVTL
EFRKRDEGEICLTLDGTEYRTGYKMRIMRVKRFIDDWNADIDKGKNPIEAMTRGKGVSLF
STGNNQFKEPAKPDQKAGKKEKVEEVDNRLYMGNIPNSMKDEDVKKMCESFGRLKAFNLV
KDPMNPDLNKGYAFFEYVDERSIDKAIKSLNGLDFKEKKLKVQKASAHQKTSQTQIQIGM
YKNVPDEKRLPIPLFAMTPSRVVQFINMISVEDLFEEDEIIHVKDDLLQECKNYGEIISI
EIPKPDEQGHATYGVGKIFVKFNHIVAAKQARYKLSGRKYNGRTVVVSFYPEHYFDIKEF
SII