Identifiers and Description

Gene Model Identifier

Contig1234.1.g122

Standard Name

U2AF1b

Aliases

Contig1234_1_g122

Description

RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam13893 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam00076 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam00642 ) Zinc finger C-x8-C-x5-C-x3-H type (and similar)
  • ( pfam10243 ) Microtubule-binding protein MIP-T3

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006491009.99860868304602e-64zinc finger protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1234.1.g122(coding)
ATGGCTGATAGGCTTGCTCGAATCTTTGGAACAGAAGAAGACAAGCATGGAGACACATGC
ACTCGGTTGCATAATAAACCAGTCGTAGCTTAAACAATTTTGATGCCTCATATGTATGAA
AATCCTCCAGCCGCCGTGGCTTTTGCAGATGGGCTTCAAGTGCCAGATCACTTACTAATT
GAGGCTATCAATCACTTCGAAAGTTTCTATGAAGAGGTGTTTCTAGAACTTGCCAAGTAT
GGGGAGGTTGAAGAAATGCACATTTGTGATAACATTGGTGAGCATCTGCTAGGCAATGTA
TATTGCAAGTTTATTCAGGAATTGGATGCTGACAAAGCGATGAGGGGTCTTAATGGCAGA
TACTATGCAGGAAAACAAATAAAGGTTGAGTTTTCCCCAGTAACAGATTTTAATGAGTCA
AGGTGCAGACTTTATGTTGAAGGCCAATGCGATCGTGGTGGATACTGTAACTTCATGCAT
CTAAAACATATGACAAAAGAGTTTCAACATGACATGAAATGCTTGATGTATTCTGAATTT
CCCGAGTACAAAGCTCACAGAGATTAAAGGAAACGTGTAGCAAAATAAAATAAGAGTATT
GAACCAGAGTCAAATAAAAGCATTTCGAAGTCTAGAAGTCCATAACCTAAAAGAAGTAGA
AGTAAAGATCGAAAGTAGAAAAGAAGATATAATAGGAAATCTTCATAATCAAGTTCAAGA
TCTAAATCAAGAAACAGTACCACTTCTAGGTCTCATTCTCAAGATAGAAGACATAAATCA
AAAAGAAAGCATCATAGGTACAGTAGAAGTAGAAGCAGAAATGAAAGAAGAGCTAGAAAT
AGTAGAAAGGATTCTCGGGTAAATTTAGGAAGAGAAACTAGCAAAGAAAGAAGAGCAATT
ATTGCAGCTTGGAATGATGAAAACGATGATAAAAAATAAGAGAAACGCTCTAAAAGGCGG
AGTCGTAGTAAAAGCAGAAACAGAAAGCATAGTAGTAGTAAAAGCAGAAATAGATCATCA
CATAGAAAGGAAAGTCACAGAAGTTAAAACAAAAGCAGAAGAAATGATCATAGCTCAGAG
AAATAAACCACAGCTTAAGATCCTAGAGCTAAGAAATAGCAATAAAGTTATTGCACGAAC
ATTAATGATGTAATAAAGCCTCTGCCTTTCCCCTTCTAAACTAAGACTTACCCCATGCAA
TTACCACCGAAAACCATATAAAATTCAGATTCTAAGCCTTAAACTATTCATGATAGCAAA
TAACAAGGAGACTAGCAGTTAATGAGTATGCTCATGATGCTTCAAAGTAATAATACTGTT
TAGCCACAGTCTGTAATTAATTAATAAAAATACTATTGA


>Contig1234.1.g122(protein)
MADRLARIFGTEEDKHGDTCTRLHNKPVVAQTILMPHMYENPPAAVAFADGLQVPDHLLI
EAINHFESFYEEVFLELAKYGEVEEMHICDNIGEHLLGNVYCKFIQELDADKAMRGLNGR
YYAGKQIKVEFSPVTDFNESRCRLYVEGQCDRGGYCNFMHLKHMTKEFQHDMKCLMYSEF
PEYKAHRDQRKRVAKQNKSIEPESNKSISKSRSPQPKRSRSKDRKQKRRYNRKSSQSSSR
SKSRNSTTSRSHSQDRRHKSKRKHHRYSRSRSRNERRARNSRKDSRVNLGRETSKERRAI
IAAWNDENDDKKQEKRSKRRSRSKSRNRKHSSSKSRNRSSHRKESHRSQNKSRRNDHSSE
KQTTAQDPRAKKQQQSYCTNINDVIKPLPFPFQTKTYPMQLPPKTIQNSDSKPQTIHDSK
QQGDQQLMSMLMMLQSNNTVQPQSVINQQKYY