Identifiers and Description

Gene Model Identifier

Contig706.0.g82

Standard Name

U2AF1a

Aliases

Contig706_0_g82

Description

Zinc finger C-x8-C-x5-C-x3-H type (and similar)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00642 ) Zinc finger C-x8-C-x5-C-x3-H type (and similar)
  • ( pfam13893 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam00076 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006491003.001096210761825e-82zinc finger protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig706.0.g82(coding)
ATGGCAGATAGATTAGCAAAAATCTTCGGAACTGAGGAAGATAAAGTTAATTGTCCATTC
TACTTCAAAATTGGAGCTTGCAGACATGGAGACACATGCACTCGTATTCACAACAAGCCA
CCCTTGTCCTAAACTCTGGCATTGCCGCATTTGTACGAGAACCCACCTGCTGCCGTGGCA
TTTGCTGATGGACTTAATGTACCACAGGATGCTCTTGTTGAAGCAGTGAATCACTTCGAA
GACTTCTTTGAAGAGGTATTTGGTGAATTGGCTAAGTTCGGAGAGCTTGAAGAAGTTATT
GTTGCAGATAACATCGGAGATCACATGATTGGCAATGTTTATGTCAAGTTCGTCACTGAG
GAATAGGCACAGTCTGCCTTTAATGGCTTAAATGGCAGGTACTACGCTGGAAGAGTTATC
TTGGCTGAGTACTCACCAGTTACTGATTTCAGAGAAAGCAAATGCAGGCAGTATAATGAG
GGACAATGTGACAGAGGAGGTTATTGCAACTTTATGCATCCAAAGCATGTCAGCAAGGAT
TTAAAACGAGCTCTGTTCAAGTCTATGTATGATGAACACCCCGAATACAGAGAACATCGT
AGAGAGTAAGAATAACTTAGAGGTAATGGATTTATAGTTTAATTTAGACGAAAGAAGAAT
GACCCGACAGGTGGTGCTAGTAAATCAAGATCTCGCAGTCCCAGACGCGGAGGTGGCGGT
GAGACTAGAGGAAGAGATGATCGTGACAGAAAGCATAGAAGTCGTAGATCACCTTCGAGA
TCTGATAGTAGACGTAGACACAGGAATCACAAGAGTGATAGATCAAGATCAAATGTAGCC
AAAGATGAAAAACGTAGATCCAGGTCAGGAGGTAGAGACAGAGATCGCGAAAGAAGAGAT
AAGGATAGAGGTGATAGAGACAGACATGACAGAGATAGACATGAGAGAGATAGGCATGAT
AGAGATAGACATGACAAGGATAGGGAGAGAGACAGAGGTGATAGAGACAGAGGAGATAGA
GCCACTGAAAGAGATAAACCAAGATAGCCAAAAGCAGAAGATGAAGATATTGCCAAAAAG
GTAATGAGATAGACTTCTGAGGAAAGAAGAGCCATGTTTGCTCAGTGGAATGAGGAGGAA
GAGAAACAGAAAAATGTATGA


>Contig706.0.g82(protein)
MADRLAKIFGTEEDKVNCPFYFKIGACRHGDTCTRIHNKPPLSQTLALPHLYENPPAAVA
FADGLNVPQDALVEAVNHFEDFFEEVFGELAKFGELEEVIVADNIGDHMIGNVYVKFVTE
EQAQSAFNGLNGRYYAGRVILAEYSPVTDFRESKCRQYNEGQCDRGGYCNFMHPKHVSKD
LKRALFKSMYDEHPEYREHRREQEQLRGNGFIVQFRRKKNDPTGGASKSRSRSPRRGGGG
ETRGRDDRDRKHRSRRSPSRSDSRRRHRNHKSDRSRSNVAKDEKRRSRSGGRDRDRERRD
KDRGDRDRHDRDRHERDRHDRDRHDKDRERDRGDRDRGDRATERDKPRQPKAEDEDIAKK
VMRQTSEERRAMFAQWNEEEEKQKNV