Identifiers and Description

Gene Model Identifier

Contig5181.0.g87

Standard Name

TUFM

Aliases

Contig5181_0_g87

Description

Elongation factor Tu GTP binding domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00009 ) Elongation factor Tu GTP binding domain
  • ( pfam03143 ) Elongation factor Tu C-terminal domain
  • ( pfam03144 ) Elongation factor Tu domain 2
  • ( pfam01926 ) 50S ribosome-binding GTPase
  • ( pfam08477 ) Miro-like protein
  • ( pfam03205 ) Molybdopterin guanine dinucleotide synthesis protein B
  • ( pfam13555 ) P-loop containing region of AAA domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYOR187W2.0004882463825047e-175TUF1 SGDID:S000005713, Chr XV
from 684030-685343, Genom...
T. thermophilaTTHERM_001518101.0003702265463573e-163Elongation factor Tu, mitochon
drial precursor...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig5181.0.g87(coding)
ATGTGGTCGAGTGTATTGAAGCACAGAGTGAGTGAAAAGAGTGGTTAACTAGGAAAGAAC
ATCATGAGAAAGCAGTCCCTACTTATGGGCATGTATCCCTCAGCCTCCTTTGCAAAGTTT
GATAGAAGCAAGCCCCATCTCAATGTTGGCACCATTGGCCACATTGATCATGGAAAAACT
ACTTTGACAGCTGCCATTACCAAGCATCTTGCCAACAAGGGTAGTGCCACATTCAGAGAC
TATCACGATATTGATAAGGCCCCAGAAGAAAAAGCTAGAGGTATTACTATTAACGCAACT
ACCATCGAGTATGAATCAGACACTAGACATTACGGTCACGTTGATTGCCCAGGTCACGCA
GATTACGTTAAGAATATGATTACCGGTGCTGCAAGAATGGACGGAGGTATCCTCGTCGTC
TCAGCAGCTGACGGTGCCATGCCACAAACCAGAGAGCACATCTTGCTCTGCAGACAGGTC
GGTGTTAAGAACATTATTGTGTTTTTGAACAAATGCGATATGGTCACTGACCCAGAAATG
CACGAGTTGGTCGAGATGGAAATCAGAGAACTCCTCAACAACTACGAGTATGATGGTGAT
AACACCCCAATCATTAAGGGTAGTGCCTTGTGTGCTTTGAACGGTACTGATCCTGAACTT
GGAGAGAAAGCCATGGAATAACTTATTGATGCTCTTGATAAAAATATCGAAATTCCAGAA
AGAGAAAAGGATAAGGATTTCTTGATGTCAATCGACAGCAGCGTGAACATCCCAGGTAGA
GGTACAGTCGTCACTGGAACTATCGAGCAGGGTAAATGCAAGGTTGGTGATGAAGTACAT
ATGATCGGAGTTAAGAGAAAGCCATCGAACACCACCATCACTGGTATTGAAACATTCAAC
AAGCAACTTGATTTCGGTGAATCAGGAGATAACGTTGGTGTCTTGCTTAGAGGTGTCACT
AAGGATCAAGTTAAGAGAGGTATGTGCCTTGTTAAGCCAGGCTCTATTGAAGTTAGAAGA
ACCTTCGAAGCTAAGTTATATATTTTGAAGCCAGACGAAGGTGGAAGATCTAAGCCATTC
TTCACTGGTTACAGACCACAGTGCTTCTTGAGAACTGCTGACGTTGCCGTCGACGTTAGT
CTTCCAGAGAAGATGCAAATGGCTCTTCCAGGTGATTCATTCGAATGCCAAATGAAATTG
AACTACCCACTACCACTCCAAGAGAAACTCAGATTCGCCTTAAGAGAAGGTGGCAAGACA
GTTGCTGCTGGTGTTATTACCAAGCTATTAGAAGATTCAGAGGCCGATCTCAAGGAAGAA
GAAGAGAGAGCCGCCAAGAACAAGAAGGCCAAGTGA


>Contig5181.0.g87(protein)
MWSSVLKHRVSEKSGQLGKNIMRKQSLLMGMYPSASFAKFDRSKPHLNVGTIGHIDHGKT
TLTAAITKHLANKGSATFRDYHDIDKAPEEKARGITINATTIEYESDTRHYGHVDCPGHA
DYVKNMITGAARMDGGILVVSAADGAMPQTREHILLCRQVGVKNIIVFLNKCDMVTDPEM
HELVEMEIRELLNNYEYDGDNTPIIKGSALCALNGTDPELGEKAMEQLIDALDKNIEIPE
REKDKDFLMSIDSSVNIPGRGTVVTGTIEQGKCKVGDEVHMIGVKRKPSNTTITGIETFN
KQLDFGESGDNVGVLLRGVTKDQVKRGMCLVKPGSIEVRRTFEAKLYILKPDEGGRSKPF
FTGYRPQCFLRTADVAVDVSLPEKMQMALPGDSFECQMKLNYPLPLQEKLRFALREGGKT
VAAGVITKLLEDSEADLKEEEERAAKNKKAK