Identifiers and Description

Gene Model Identifier

Contig14585.0.g91

Standard Name

TSTd

Aliases

Contig14585_0_g91

Description

Rhodanese-like domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYOR251C8.996347186365117e-39TUM1 SGDID:S000005777, Chr XV
from 803464-802550, Genom...
T. thermophilaTTHERM_009207600.000000000003998907168546896Rhodanese-like domain containi
ng protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14585.0.g91(coding)
ATGATCAATAAAATAGCCAAAAAATAGATTGCATCAACACTTTCTTTGTTGAGATTCCAA
TCCAGAAGCATTTCAACTTATAGAGAAAAGTATTTGATTGAGACAGATGCGTTAGATAAA
CTTATCCAAGACAATTCAAAAGATCTTAAAATATTAAATGGTTCTTGGTTCATGCCCTAG
ATGAATAGAAATGCTAAATAAGAGCATGCTTAAGAAAGAATACCAGGGGCTAGATTCTTT
GATATTGATGCAATAGCAAACAAATTAATAGACTTACCTCACATGATGCCATCGTTAGAT
GATTTTAACAAACACATGTGGGAGTTAGGAATCAAAAGAACTGATAACATCGTTTGCTAT
GACAATTTAGGAATCTTCAGTTCACCTAGAGTAGCTTTTACCTTTTAATATTTTGGAGCT
CCAAATGTCAGAGTTCTAAATGGTGGTTTTCCCAAGTGGCTAAGAGAATCAAGAAAAACT
GAAAGTGGACCAGATAGAGAATGGGAAAGAGGGAAGAAAGAGGATTATCTTTATACTGAA
GAGAATCCTGATAGATTGATAAGAGAAATTAATTAAATGCACTAAACAGCCTATTATGTG
TCCAACAAACAATCAGACACTTAAATCATTGATGCCAGAGCTCAGTAGAGATATCTTGGT
GAAGTAGATGAACCAAGAGCTGGCTTAAGAAAAGGACATGTTCCAGGTGCTAAGAACATG
TTCTTCTAATTGTTGATTGATCCTGAAACATAAACATTCAAGACTGACAAAGAGCTTGCT
TAATTGTTCCTCAAGCAAGACATAGACACTACTTTGAGTACTGTCACTTATTGTGGATCA
GGGTTGACAGCCTGTGTTGTGAATTTGGGTTTAGAACTCTTAGGCAACGAAGGGAAAACA
ATCCTATATGATGGCTCTTGGACTGAATATGGACAACATCCAGAACCAGATTTCAAGAAA
GGCGGCTTCAATTAAAACATAAATGAAGTGCTTGATCAAATTGCAATGAGCAGAGGCCAT
GATTAATATGTATAATATAAGGGAAGAGTAGAAGTGTAAACTCAACTAAGAGAATAGGAA
AATAAAGCTGCACAGTAGAAAGAAGAAATGTTGAAATAGTTTCCCAAACATCTCTATAAT
TCTGATGAAGAAGAGTCGGACTACGATGTAAATGAAAAAGAAATGCATGCTACTAGCCGT
ACTAAAATGAATTAGAGAAAATGA


>Contig14585.0.g91(protein)
MINKIAKKQIASTLSLLRFQSRSISTYREKYLIETDALDKLIQDNSKDLKILNGSWFMPQ
MNRNAKQEHAQERIPGARFFDIDAIANKLIDLPHMMPSLDDFNKHMWELGIKRTDNIVCY
DNLGIFSSPRVAFTFQYFGAPNVRVLNGGFPKWLRESRKTESGPDREWERGKKEDYLYTE
ENPDRLIREINQMHQTAYYVSNKQSDTQIIDARAQQRYLGEVDEPRAGLRKGHVPGAKNM
FFQLLIDPETQTFKTDKELAQLFLKQDIDTTLSTVTYCGSGLTACVVNLGLELLGNEGKT
ILYDGSWTEYGQHPEPDFKKGGFNQNINEVLDQIAMSRGHDQYVQYKGRVEVQTQLREQE
NKAAQQKEEMLKQFPKHLYNSDEEESDYDVNEKEMHATSRTKMNQRK