Identifiers and Description

Gene Model Identifier

Contig22678.0.g101

Standard Name

TSTc

Aliases

Contig22678_0_g101

Description

Rhodanese-like domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_009207602.000470901975128e-28Rhodanese-like domain containi
ng protein
SGDYOR251C2.0002795641672355e-21TUM1 SGDID:S000005777, Chr XV
from 803464-802550, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22678.0.g101(coding)
ATGTTCTTGAAATACATCAACAAACCTAGCCTATAAAATGGCAGATTTTTCAGTGCTTAA
TCAGCTAGTTAATAAACTAATAATGTGACAATCTCTGCTTAACAATTGCATTAGCTCATT
CTCAACTAAGCCATTTCTCCATCAGTGACTATTTTCAATGCTACTTTAAAGAGAGCAGAT
TTAAATCCTCGTGAAGATCACATAAAGGCTAGAATACCCAGTTCAATCATGTATGATTTC
GAAAGATTAGCAGATTAGTCTCAATCCGCACCTTATATGCTGCCTACAGATGAATAATTC
AGCAAGGAAATGGAAAAGATGGATGCTAGAAAGAGCGACACTTTTATTGTTTATGACAAG
TCAGGCATGCTTTCAGCTCCCAGAGCATATTGGATGCTCAAATCTTATGGAGTCTCAAAT
GTAAAGATACTCGATGGTACATTTAACAGATGGGTTTAAGAGGGTTTTGGAGTTGAATAA
GGCGAGACAGAGAACGCTTTTAAAAGAGTGAGATAAAGTAAACCAAAAGCTGATGATTTC
GATTTCAAAATTGATTAAAACAGGTTCTTAAAATTTGAAGAAGTGCTTAAAATAAAGGAG
ATTAATTAACAGAAAACTTAAAGTGAAAGAGTTCCATTTTTGGATTCAAGATTTACAAAG
AATTACGATGATGGACACATACCTACCTCAGCAACCTACCCATTTACTGAGGTCTTGAAC
GCAGACAGATCTTTTAAAACTAAGGAAGAGCTTATTGCTGGTTTCAAAGCTCAGGGAATA
AATGACCCAACAAACGATAAAGTAGTATTTACTTGCCAAAGAGGCATTACTGCTTGCATC
TTGGAAGCTGCAATATCTATCCTTGGCAACACAAATGCTCAAGTTTATGATGGATCATAT
GAAGAATATCAAAGGAAAATTAAAAATATCTAGTAATGA


>Contig22678.0.g101(protein)
MFLKYINKPSLQNGRFFSAQSASQQTNNVTISAQQLHQLILNQAISPSVTIFNATLKRAD
LNPREDHIKARIPSSIMYDFERLADQSQSAPYMLPTDEQFSKEMEKMDARKSDTFIVYDK
SGMLSAPRAYWMLKSYGVSNVKILDGTFNRWVQEGFGVEQGETENAFKRVRQSKPKADDF
DFKIDQNRFLKFEEVLKIKEINQQKTQSERVPFLDSRFTKNYDDGHIPTSATYPFTEVLN
ADRSFKTKEELIAGFKAQGINDPTNDKVVFTCQRGITACILEAAISILGNTNAQVYDGSY
EEYQRKIKNIQQ