Identifiers and Description

Gene Model Identifier

Contig13271.0.g66

Standard Name

TSTa

Aliases

Contig13271_0_g66

Description

Rhodanese-like domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

  • intramolecular transferase activity, phosphotransferases (IEA) | GO:0016868

Biological Process

Domains

  • ( pfam00581 ) Rhodanese-like domain
  • ( pfam02879 ) Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain II

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYOR251C8.99902975825788e-19TUM1 SGDID:S000005777, Chr XV
from 803464-802550, Genom...
T. thermophilaTTHERM_009207602.9992476920535046e-16Rhodanese-like domain containi
ng protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13271.0.g66(coding)
ATGGAATCATCAAAAGAATCCCCTGTGTTTATTGACACTGAGAATCTAGCCAAATTGTTG
GAAACAGACAAAGACTTGAAAATCTTTGATTGCTCTCAAAATATTGGACTCCCTGATGAA
CAAGATCCAATCCTCACCTTCCACAATCTTCATATCCCAAGAGCCCAATATATCGATTTG
AGATATTTAAGAGATATGAACTCACCCTATCCAAGCATGGCCCCACCTCTAGAATTGTTC
AAAGATAACATGAAGAGGCTTGGAGTTAAACTTACTTCAAGAGTTGTGGTCTATGATTCA
AAGTCTGGATATTTAGCAACTAGAGCTTTCTGGTTGTTCAGATCTTTCGGAATCCTTGGA
GTATCAGCTTTGAATGGTGGATTGAACAAATGGGTGAAGGAAGGAAGACCAACAGAGTCT
ACAGAGAACATTGGAACTCCAGATGACTACAACTTCACTTTTAACGCTTAAAATTTAGCT
ACCTTCGAACAAATAATTGATTTGGAGAAAGTTCATGCTGAGGGTGGAGCCAAGGACACT
CATGTTCTTGATGCCAGACCAGAGAGTGTTTTTGCAAATGGACACTTAAAAGACGGCGAG
AGTTTGTTCTTCAAAACTTTACAGAATGAAGATGGTACTGTTAAGACACCAGAACAAATC
AAAGAAATTTTAGCTCACAAAAGTATAGATATAACCACAAACAAAATTGTCGCTTCATGC
AATGCCGGCACTTCTGCCACATACTTATATGCTGCTCTTTAGCATGCAGGCTGCAATGAT
CTTAAAGTCTACGACGGCTCATGGCAAGAATATTCTCAGAGAAAACCAAAGGAACAATGA


>Contig13271.0.g66(protein)
MESSKESPVFIDTENLAKLLETDKDLKIFDCSQNIGLPDEQDPILTFHNLHIPRAQYIDL
RYLRDMNSPYPSMAPPLELFKDNMKRLGVKLTSRVVVYDSKSGYLATRAFWLFRSFGILG
VSALNGGLNKWVKEGRPTESTENIGTPDDYNFTFNAQNLATFEQIIDLEKVHAEGGAKDT
HVLDARPESVFANGHLKDGESLFFKTLQNEDGTVKTPEQIKEILAHKSIDITTNKIVASC
NAGTSATYLYAALQHAGCNDLKVYDGSWQEYSQRKPKEQ