Identifiers and Description

Gene Model Identifier

Contig96.0.g104

Standard Name

TSR2b

Aliases

Contig96_0_g104

Description

Pre-rRNA-processing protein TSR2

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam10273 ) Pre-rRNA-processing protein TSR2
  • ( pfam10514 ) Pro-apoptotic Bcl-2 protein, BAD
  • ( pfam03064 ) HSV U79 / HCMV P34
  • ( pfam05642 ) Sporozoite P67 surface antigen
  • ( pfam07423 ) Protein of unknown function (DUF1510)
  • ( pfam09919 ) Uncharacterized conserved protein (DUF2149)
  • ( pfam06217 ) GAGA binding protein-like family
  • ( pfam08432 ) Fungal protein of unknown function (DUF1742)
  • ( pfam14181 ) YqfQ-like protein

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004463200.000000100009565553302hypothetical protein
SGDYLR435W0.00003998524687536623TSR2 SGDID:S000004427, Chr XII
from 1006378-1006995, Ge...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig96.0.g104(coding)
ATGGAATCAAATAGCACTACTACTCAGCAATAATAGCAATCCCCTCTAGACCAGCAAACT
CTCTATAAATTAGGCGTTGAAGCTCTTCGAGAAACAGCTTCCATCCTGATTTGCAACTGG
ACAGATTTGAATTACGCCATTGAGCAGGGTCTCAGCACAAAGAACAGAAAGTTGAACCTT
GAGGATGAGAAGGAAATCGAGCAGCTCAAGGAACTTGTGAGTTATCTCAAGAGTGAGAGG
CAAAGCGATATGGCACTCAGGAATTAACTCATATAACACATGGTCGATATCAGTTTGTCA
CAAGAAGTAGAATTAGAAGACTATGAGGATTGTTTGTTGGACTTTATGGAACTCAATTTT
AACATGGTCATTGAAGACAACTCAGCCAAAGAAATTGGCAGAGCAATCATGAAAATTAGA
CACTAATTGTTTAGCAGTGCTTAAAATAAATCGATACTTGAATCTGAAGAACTTGAGAAA
TTGAGAGAATTTAATGAGCAGAAAAACTAAGCTAAAAAACGCAGATAAGAGAAAGAAGCA
GAGGAGAAAAAGCAGAGAGGCAGTGATAGTGAAGAAGATGGCAGTGAAGATGATGATGAA
GAGATGGAAGAAGACGATGGTAATGGAGACAGCAAAAGTAAGAAAGATGTGCCTGAGTTG
ATTCAAGCTAAACCTACAGGCCCTGTAATTGATGCTGATGGATTTGAAATGGTGACTACC
GAGAAAAAGGGCAGAAGAAGATGA


>Contig96.0.g104(protein)
MESNSTTTQQQQQSPLDQQTLYKLGVEALRETASILICNWTDLNYAIEQGLSTKNRKLNL
EDEKEIEQLKELVSYLKSERQSDMALRNQLIQHMVDISLSQEVELEDYEDCLLDFMELNF
NMVIEDNSAKEIGRAIMKIRHQLFSSAQNKSILESEELEKLREFNEQKNQAKKRRQEKEA
EEKKQRGSDSEEDGSEDDDEEMEEDDGNGDSKSKKDVPELIQAKPTGPVIDADGFEMVTT
EKKGRRR