Identifiers and Description

Gene Model Identifier

Contig13602.0.g10

Standard Name

TSR1

Aliases

Contig13602_0_g10

Description

Protein of unknown function (DUF663)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007845701.9994274381022833e-63Transketolase, C-terminal doma
in containing p...
SGDYDL060W1.0001055852164665e-60TSR1 SGDID:S000002218, Chr IV
from 341619-343985, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13602.0.g10(coding)
ATGGAATTCAGACATAAAGCTCATCTTTCCCAAACAAATAAATCCCATAAGAAAAACAGA
TCTAAGTCTGGTGGTAAAATTGAGACTAAAATTAGAACTCTGATTAGTTCATCACATGGT
TTAGTTAGCAAAGATCAGAGATTTAATATGCAAAATGAAGCCAGAAAATTAAAGAGAGAA
GAAATGATTATGAAGCGTAGAGGTCTGAACTTTATCTCAGATGCTGCAGTTGAAAATTTA
GACGATTAATCTGTGTCAGTATTGGAATAGGAGGTAGATAATGTTGCACCCAAGATCGTT
GGTATTCTTGGATTGAATAGCGCATGCGATATATCAGGATTGAGAGCAGAAATGATTAAA
TATTGCTGTGAATATCAGCAGACACTTAATAAGAGCAAACATGACAAAAATCAAGTGGAA
GAAGTAAATATTCATGATGACCAATTCAAGGCATACCTCTGCCCTAATCCAGGCAGTTCT
AATAACTTCGGAAGCAAGAAATAGAGACTTATATTCTTAGAAATAAATAGAGATGATGAT
AACTCCGTATTGGAAGTCGGTAAAATTGCAGATTTAATCGTAGTTGTAATGTCATGCAGC
GAAAGTGATTCTAAGGGATTGAAAGTAGATCCAGATAGATTCTCTAATGCTATTGATGAG
CAGGGATATAAGGCTTTAAGTTTATTAAGATCCTCAGGTTTACCAGGTCTCATCGGTGTC
TTATAACATTTAGAAAGACAAAAAAGTTCAAAGCAACCTTAACTCAGAAAATTGTTCCAG
AGGTATTTCGAATCAGAGTTCACAAACAGACATAAATTTATGAACATAAACTTGCTGAAT
TCTTAAACTGATGTAAATGCACTGTTGAGATAAATCGCAGTTATCTATCCAGAAGATATT
ACATGGAGATAGAATAGATCTTACATGCTTGGAAAACTTTCATAAATCTAAAATAATGAG
CTACATGTGGAAGGTTATATCAGATAAAATTTCCTTAATGCCAAGAGATTAATACACATC
ACTGGAGTAAACAGTCATTTAGCTTTCAAGATTAAAAGAATAGAAATTGCCTCAGACCCT
TGCCCCATGAAAATCAGCAGCAAAGAGAAAGAGAAGATCATGTCAACTTCTAAGGCTTAG
AGTATAGTACAGAGTAGAAAAGCTTCAAGAAAGGGTTCCATGGATGATGTGAGTTAAAGC
GCATCTGTTGCAGGGGATAACGTAGGCAGAGTAATTTAACTTGCCAAGGATCTAGAACGT
GACCCCGCTTCGATAGAAAACAACCCAGGTCTCTTCTGTGCCGAATAAACCTGGCCAACT
GAAGAGGAAATGAAATCATCTAAGCAGTCAAAGAAGACAAAGCAGCAAGATGACGACGAC
ATGCAATTGCAATAAGCCGAACATATGAACCTTGAATCTTCATATCCAGTAGCTTAAGTA
AAAACCGGACTTGAGGAAATGTTTGATAGAATGGAAATTAAGGTGATTGGTGGTAAAAAC
GAAGACAATAAGTCCGAGAAGAGCATGGAAGACTTGGAGGATGATGACGATGAAGATGAC
TTGAATAACACCATGTATCAGGATGATAATAAAATTTCTTAAAAGCATCAGAAATACACA
GATTTAGAAAGCAGAGACAAAGACGATATGGACTTCCCCGATGAAGTTGATACACCCCTC
GACATCGAAGCAAGAAAGAGATTCTACAAATACAGAGGAATAAAATCGATAAAGAATTGT
GACTGGGACCCCTATGAAAACCTTCCACCCAGTTACTCTAAAATCTGGCGTTTCCAAAGC
TATCAATAAGCCCACAAGGACTCTGTCCTCCAAACCATCGAAGAGGGTCTCCCACTCAAT
GGAACTTACCTAAGGTTAGTACTGGAAGTTGATGATCAAACTCTCTTGAGCAATGCCGAT
ATTTTGCAATAAGGGAAAGCATTGATCTTATCAACTCTATTCCCACATGAATGCAAACTT
AGTGTTATGCATTTCAAGATCTAAAGAAGCTTCGAGAACAAAGAAACCGTTGAAAGTAAA
TCAGAGCTAGAAGTTCATTGTGGTTTCAGAAAAATGACTATAAAACCAGTCTTCAGTATC
GAGACTACTCCAGGTGGTCACGCAGGTACAGGTGAAAAACTAAAATATATGAGGTTCTTA
AGACATGATATGAGTAGTATTGCTTCAGCTTTCTGCCCAATTGTGTTTGCACCTTGCAAG
ATTTTGATGTTCAGAAAAGACAAAGAAACAAGTCAATTGAGTGTTATAGCAACAGGTGTG
GCTCTACCTCCAAACCCCCTTGCAATTATTTTGAAGAGAATTATTTTGACTGGGTATCCC
TTGAAGGTGCACAAAAAACGCGCTGTTCTTCGTTACATGTTCTTCAATCCAAAGGACGTT
AAGTATTTCAGACCAGTTGAACTATACACTAAATTCGGTTTAAGAGGACACATTAAAGAC
TCACTAGGAACTCACGGTCTTTTCAAAGCACAGTTTAACGACTTCATGAAATAAAACGAT
ACAGTCTGCATGCCACTTTACAAAAGATAGTACCCAGTATGGTTCGAAAAGACATGGACT
GGATAGGAGCCAATTAAAGAAGAGGAGGAAGATCAAGAAATGAACAACTGA


>Contig13602.0.g10(protein)
MEFRHKAHLSQTNKSHKKNRSKSGGKIETKIRTLISSSHGLVSKDQRFNMQNEARKLKRE
EMIMKRRGLNFISDAAVENLDDQSVSVLEQEVDNVAPKIVGILGLNSACDISGLRAEMIK
YCCEYQQTLNKSKHDKNQVEEVNIHDDQFKAYLCPNPGSSNNFGSKKQRLIFLEINRDDD
NSVLEVGKIADLIVVVMSCSESDSKGLKVDPDRFSNAIDEQGYKALSLLRSSGLPGLIGV
LQHLERQKSSKQPQLRKLFQRYFESEFTNRHKFMNINLLNSQTDVNALLRQIAVIYPEDI
TWRQNRSYMLGKLSQIQNNELHVEGYIRQNFLNAKRLIHITGVNSHLAFKIKRIEIASDP
CPMKISSKEKEKIMSTSKAQSIVQSRKASRKGSMDDVSQSASVAGDNVGRVIQLAKDLER
DPASIENNPGLFCAEQTWPTEEEMKSSKQSKKTKQQDDDDMQLQQAEHMNLESSYPVAQV
KTGLEEMFDRMEIKVIGGKNEDNKSEKSMEDLEDDDDEDDLNNTMYQDDNKISQKHQKYT
DLESRDKDDMDFPDEVDTPLDIEARKRFYKYRGIKSIKNCDWDPYENLPPSYSKIWRFQS
YQQAHKDSVLQTIEEGLPLNGTYLRLVLEVDDQTLLSNADILQQGKALILSTLFPHECKL
SVMHFKIQRSFENKETVESKSELEVHCGFRKMTIKPVFSIETTPGGHAGTGEKLKYMRFL
RHDMSSIASAFCPIVFAPCKILMFRKDKETSQLSVIATGVALPPNPLAIILKRIILTGYP
LKVHKKRAVLRYMFFNPKDVKYFRPVELYTKFGLRGHIKDSLGTHGLFKAQFNDFMKQND
TVCMPLYKRQYPVWFEKTWTGQEPIKEEEEDQEMNN