Identifiers and Description

Gene Model Identifier

Contig16632.0.g73

Standard Name

TSFM

Aliases

Contig16632_0_g73

Description

Elongation factor TS

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001456305.000574419929632e-30Elongation factor TS family pr
otein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16632.0.g73(coding)
ATGCACAGTTTATCATTAAGATATCTCTTAAGAGCTTCCAGCCAAAGAACACCTCAAGCA
GCCCTCCAAAACTAATCTTTAGTCATGGGCACAATGATTCAGAGACTATTCTCATCACCA
GTTAATTCTAAGCTTGTCAAGCAGTTGAGAGAAATGACAGGCAGTCCACTTAAAGATTGC
ATGAAGACATTAGAGGAGACCAATGGAGATCTTGAATAAGCAAAGGAACTGTTGAGAAAG
AGAGGATTAGCAGATGCAGAGAAGAGAGTAGGTAGAGCTACAGCTGAAGGGTTTGTGGGC
ATGAAACTAGATAGACAGAGCAAGCTATTGACTATGATTGAATTGCACTGTGAAACTGAT
TTCGTAGCAAAGACAGATAAATTCAAGGAGGGTATTGAGAGATTAGTAGAGACATTGCAT
AAACAAGGCCCAAGTGTGAATTTCCATCAAAATGACATCTCAAACGTTGATAAAATTAAT
GCTTTGATTAAATCTCTCAAGCTAGATATTCCACTCGATCACGATCTTAAGGAGTAGACT
ATTGAGGAAGGTATAAAGTATGTTATTAGCAAGACTTAAGAGAATGTGAGATTGGCTAAG
ATCTATCAAAGACAGTGGAACCCAAGCGAAGGGGAAATCCTCAACGCTTATGTTCACAAC
CCTGAACTCCTACATAAAGTTACTATTGGAAAGATTGGATCATCAGTGTTGATGAAGGCT
GAAGACAAGAAGCACAATGCAGAGTTGGAAGCTCTATCACAGTAATTGGCATTGCACATA
GCAGCTATGCGTCCTGTATACCTGAATAAACAGCAAGTGCCCTAAGAAGTGAAGCAGAAG
CTCTTGGAAGAGGGTCCAGCGGACAAAGCTCTATGGAAGATGTTCACCAAGGACGTGCTA
ATGGAGCAGGAACTCGCCACCAGCGAGGAGTCTCTGAAGGTCAAGCAGTTGATTAGGGAT
AGGGAGAGCGAACTTGGCTCACCACTACTCATCAAAGAGTGGACTCTCTTCAATATTGGC
GCATGA


>Contig16632.0.g73(protein)
MHSLSLRYLLRASSQRTPQAALQNQSLVMGTMIQRLFSSPVNSKLVKQLREMTGSPLKDC
MKTLEETNGDLEQAKELLRKRGLADAEKRVGRATAEGFVGMKLDRQSKLLTMIELHCETD
FVAKTDKFKEGIERLVETLHKQGPSVNFHQNDISNVDKINALIKSLKLDIPLDHDLKEQT
IEEGIKYVISKTQENVRLAKIYQRQWNPSEGEILNAYVHNPELLHKVTIGKIGSSVLMKA
EDKKHNAELEALSQQLALHIAAMRPVYLNKQQVPQEVKQKLLEEGPADKALWKMFTKDVL
MEQELATSEESLKVKQLIRDRESELGSPLLIKEWTLFNIGA