Identifiers and Description

Gene Model Identifier

Contig4985.0.g20

Standard Name

TSB51

Aliases

Contig4985_0_g20

Description

tRNA synthetase B5 domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig4985.0.g20(coding)
ATGAATATCATGCTTTTCACCGGAGAAGATAACAACTTGGAAGATTTCATGAGGGCTTTA
AGAACACTTGAAATACAAAACATAAGTTTTAGCAGTAGCTTTTTAAATGAAGAGTTGTTG
CAAGAATACTCTAACTATTTCAAGGAAATTGGTGATAACCCACCTAAAGAAATCAGTGTA
TAGAATTTAATAGAAATCAGAATTGACTGCTTCACACAACTATTTGCTGATTTTTGTTTC
GAGTTTTTGGATGAGATAAAGGAAAGTATCGGAATTAAATAGGATTTTTCTCAAATTTGC
TCAATTTTACTTAAGAGAGTTTAGAGCAGACAGACTCATACCAGAGTAAAAAACAATAAA
TTAACTTTTATGAATGAGGCTATTAAACTAAAAAATGAAGGAAGCATTAAAGTCTAAACT
GATTTGCCAAATTATGATGATATTTTTAGCAATCTTTAAAAGTTAAAACTTGATCAAGCT
TTTATCAAACTTAACAGTGACTGGAGATTGCTAGATTCAAATTACCTTGAAATCATTACA
CAATTCAATCTATGTGTTGGTGCTTTTGTTTTTGAGTAGAAGAATTTCAAGAGTTATTAC
CCTTAATACCTTGACTTATTTGAACAACTGTACTACGAGAATATTGACTATATCGTGGAT
TAAGTGAACAAATTTGACAATAGACCAGTTGGTAACCAGATTATTGATCAAAACCTCCAA
AATATGCTTGAAAAACTGGAAATTAAAAGTTAGATGGAGGACACATAATTCTAGATAAAG
CAATTTGAATTCATAATCACAGAAAATTTCCAAGGAAACAAGATTTATATGAGCATTGAA
AGAATTGAGACTTCCAAGATAGAATTTGATGAGAATGAATAAGATTAAGTGAGAAGTCAA
TTTTTAAATTTAAATTGA


>Contig4985.0.g20(protein)
MNIMLFTGEDNNLEDFMRALRTLEIQNISFSSSFLNEELLQEYSNYFKEIGDNPPKEISV
QNLIEIRIDCFTQLFADFCFEFLDEIKESIGIKQDFSQICSILLKRVQSRQTHTRVKNNK
LTFMNEAIKLKNEGSIKVQTDLPNYDDIFSNLQKLKLDQAFIKLNSDWRLLDSNYLEIIT
QFNLCVGAFVFEQKNFKSYYPQYLDLFEQLYYENIDYIVDQVNKFDNRPVGNQIIDQNLQ
NMLEKLEIKSQMEDTQFQIKQFEFIITENFQGNKIYMSIERIETSKIEFDENEQDQVRSQ
FLNLN