Identifiers and Description

Gene Model Identifier

Contig22731.0.g86

Standard Name

TRRAP

Aliases

Contig22731_0_g86

Description

hypothetical protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYHR099W1.999002769139511e-37TRA1 SGDID:S000001141, Chr VII
I from 302761-313995, Gen...
T. thermophilaTTHERM_009787709.001232279470736e-16hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22731.0.g86(coding)
ATGAACACAGGTATAAATATACCAAGCATGGATGATAGCCAGAGAGTTTAGACTTTGCTT
CAGTAATTACGCACTATTAAAAACAATGAACCCGAATACTTGAGACTTCTTCACGAGGTC
ATAGAATATATGGAATATTTGCAACAACCGATGAACCAGTAAGCGACTCTGACCAACTTC
CAGAGCATCATAATTCCCGAGATTGTCAACATTATGAACGAAAAAGAGCCCACAATGGTC
GACAATATCCGTCACAAGATCAGAAGGTACTCCCTAGAGATACTACTCATAGTTCCCTTC
CCTGACTAGAGAGAGAACATACCTTGTGAAGAGATTATCAAACTGATCATTGATGTTTTG
CTAAACGACAATGAAGAAAACGCGGAACTAGCAATTAAAATCTTACTAGAAATACTTAAG
TTCTACAAGACAAACTGGGATGCTCTCGAAAACTACTACATACAGTTCATTCAATACTGC
ACCCAATTATTCCAAAATCTGCCATCGAAGCTGTAGGAAATCAAGCAAGTAGACGATTCA
GGAGCACCAATCAACAGACTCAACTAGAGCTAGGATGAGTAGGTTCTCACTCCTTCAACC
AAGTCAATGAAGAACATATCCTTGGTCACTCACTACTTAATAATGCTGAACTAAATCTTC
GACCAAAAACTTAAACCCTACATCCTACAGCTCTTAGACGTGATCTTCCCAGCTCTCCGT
CAGTTCCCAGACAAGATACTGCCCGAGGTCAAGAACATGTCGATATACATGGAGTTCTTG
GACATCCTCAAGAACATTCTCTCGTTCTTTACATTCATTTTCAAGAAGTCCTACACGGAG
GAGATTCTTGACAATCTCGACACAATCATCGGCTTACAGTTCAAGATACTTAAGAACACG
CCGCAGCATGGCCAGTGGATCAGAAAAGACATCCTGCACATGATCAAGTATGAGATACAA
GAGACCACTGCTTTTGAGAGGGCTGATAGAACACAAGGGTATTAAGGGCGCGAACACTTG
TACAAGAAAAGGAATGAGTGTCTCCAAAACTATCTTGACGACTTCCTCGATGTTAATACA
ATCTTTGGCAAAGGTAAACTTACCAAAGAGCTGTAGTACTATGGTCGCTCATTGATAGTG
ACTTACATCTCCCAGTTTAGGGACCCAATGACAGAAGCGTAATTGAAAAAATGCCTCCAC
ACAATCATAAAAATCATTCTTGATCCTTCCATAAGCTTCGTGATGCGAAGCACCTACATC
TTCCTTCTATTCCGTAAGTATGAGGAGCTCTACTCCAAGACTTAGCAGAATCAAAACTAT
ATCAACCCTCACTGCGAGCTACAGCTTGAGATACTGGAAGCTCTGGTTATGATGATGAAG
GAGCTAGATTCACACATCAAGATCGCTACCGATGAAATGGTCAGCTTCAAAGAGCAAGTT
ATCTCATTGAGAAAGAGTAGCAAGAAGTGGATGAACGATATCGAGCAGAGAGACATCAAC
TTCAAGGAGTTATTTCTCTAGGATGACTATTAATTCTATGAGGTTGGCAAGCAAGACCCA
ATTGAAGTAGACAAGGTTAGGATTCAATACCTGTTTAACTCATTCTTCGATACAAATAGC
TCGCTCTCTCAATCTCAACAACATGAGATAAACAGAGACAAGCTCAAATACTAAGCATTC
ATTTCCTTGACTGATTAGCAACTTAACGAGTACCTCGATGCATAGAAGGAAAATACTTTA
AAGTTGGTCAGAAACATCACTACTATTATCGACACTATTTTGCTCAACATTTAAGAGACA
AGAAGAACTAAGTGCCTCAGACTGCCTGAGATGAAACTTATGAGAAAGCTACTCATTAGC
GGAAGCAGAATCATTCAAAGCCTCTACGAGATGTTCACAGTTGACAAGGAGAAAGTCAAT
GACTTGATTAAAAAGTTTGCCAAGATTTTCTAGTAAATGCGAGTCTTGCAGTTCAGAGAT
CTCTTTAGCTCTGTAGAAGACGAATTCTTCGGCTATGTCATCGAAGTGAAAGCAACCAAA
GGCGATTCTGGAGTCTATCTCTTTGCTGACTACCTTATGAGTTTCTAATAGAATCAGCCT
AACTAAATGCCAAATCCGATAAACAAGCATTTGGATGACTAAGCAGCTTACATGCTAGAA
ATATTTTACGGCTATATCAACTCGAAGATGAGAATCTTCAATAAGGCTATGGAAACCGAA
CCCATACTTTCTATGAACGAAGCTGACTAGAGATTCGCAAAAATAGCCACGCCAGACCTT
CAAGATGCACTTTAGAAGTTGACTTTAGCTATTGGCAGCAAAGCTTTATCAAAAAGGAAT
GATCTTAGAATGAAAAACCTATTCTTCTCCGTCTTCGTGTTCTGCGTTAAGTGTACTAAG
TCCAGCAGGATTATCCCTTACTATTACTCTGTGATCCGCAACTTATTCAAAGAGTTGAAC
TTGACAACAATTAATGACAACTCAAACTTCGTGAAAGAATTCATTCCTCTCATGCAAGGC
CTCTTAGAAACGTTTCTATAAGCCAAAGATGAAGCTCCTTTTATCAAGGAAACGAATGAG
ATATGCTACTCTGTTCCAGCAAAACTAAAGAACTTGATTGAGTACTTGCCTATTGTCTCA
AGACCACTCATTGATTCTATGAAATCTAACAACATTGAACTTATTGAGAGTGGGATTAAC
ACCATCTAGATTTGGGTTTCAGCACTTGGCAACTACCCAGAAATCTTAGATCCTGTCATT
GACAGCATAATACCAGAGTTGAATAGTTTACTCTACAAGATCTTGTATCTTTTCCCTAAC
TATAGTTTCAAGCTCCTGGGTAAGTTTGGTGCAAAGAGCAGAATGTACAACGAAGATAAA
GAGTTCAAATCAAAGAATTATCCTGAAGATGGTTTGAAGATTGACCTCGAAGACAAAAGC
TCTGGAAAGCAGATTAGTCTGGGCATTGATACAGCTATCGATGTGGTATTGCTGAAGATA
TTTGACAGTTTCCACAAGTTCAATCATGCTAAGCTACTTGAAGCTTACAAACTCATTAAA
GGTGCATTTATTTGCTTCATTGAGCCACAATTTGATATGGACTATATCATCGCATCAATC
GCAAACGCCAAAGTGAAGAATACAGACTTGCTTACTTAGTACAACATGAACTCAGCGAAA
TATTTTGACACTAAGCAGACTCAAATTAAGGTCAGTGCCCTTGGTAAAGCTTCTGAATCG
CATGCTTTCGAGAAAATTCTGAAATGCCTCTTGATTGCTTGCTCTCTGCCCAAGGATAAT
CCAGAGACTAAAGTTGTTCATGGCAAGGTCAAGAAGTTCTTTAAGTGGGTTACTCAGTAC
TTCACATTGATCTATATTTGTAAGAACGGCAAACTCAGAGAGAATCTCGTTAATGAAATT
AGCCCTTTGGTTTTCATGGAGAATATCTGCGATTTCCTTTACTTTAACCTTGTTCAAGGC
ATGCCTAAAAGTCAAAACAGATCGTATCACAAGGGCTCAATAACAGCACTCAAGACCATG
ATTAGAATGATTAAAGACTTCTATGGCGAAGAGGATGATTAAATCTATGAAAATTTGGAA
TTCATTCAGTACTTAATTTAGAAGATCTGCCACTTAGCCTATGGCCATGACATGCCAAAG
AAAGTTGCTGCAAACAGAGCACTCTAAATCATAATTTAAGAACTGCCAAGGCGTACTATT
AAATATCATTGGTAGACCTTAGTAGATTCAGTATTCCATGTCCTTGTTACAAACAATGAC
TCTTTGGTATATCAGGTTGAGAAGGAATGCAGATCCACTCTTGACCTCTTTATCGGAAAG
ATAGGACTTTACACTAAAAACATACTGGACACTATTGATGACTCAGAGAAAGACTTCTAT
TCAGCCGTCTTAGACAGAGTACTGGTTAACATAGTTCAGAGCAGAAACTCAGCAAGACAC
ATCGGCTAATTCTTTATCGAAGAAATTTCAAAAAAGACTGGACACAGCGTAAAATCTATA
CTCTTAAGAGTTAATTGCAATGTTTACGTGGGCCAGCTTTTATAGCAGCAGTAGTAACAG
TAATAACAATAATACTAGCAATAACTTTAGTAGTATCAACAGTAGCAGTAATTGCTTTAA
TAGCAGTTGTAGCAAGCAGCTGCAGGTGGGAGCCAGCCTTAACCACAGCCTCAATCCAAT
CCAATCTCAGCTCCACAGCAACCTAAGCCCATAACCTCAGCCTAGATCATTGGCTCGCAA
GATGTTTCCTGGTCTGCCTACCTCACTCTGAGTCAAGTGGAGAACCGAGCAAAGCAGATC
TACCCACTCTTCAAGGGCGGCTACACTTAAGTCCAGCATCTCGTCACCTACTTAGATATC
ATTGAGTTTTGTCTGAAGCATCAGGTGCTTGATCCCATCGGCAAAGTCCACATATACTTG
GCTATATGCGAGCAGCTTATCAAGGTCTTGGAGGATGAAATTGAAAAGCATGAACCCAGA
GCTAAGACAGGTACTGGTGCTAATGCCCCTGAATAAGAACAGCCATCAAGTTTTGCAAAT
GACCCTATGGTTAGCAATGCAGCTAAAGCCGCAGTGAAATACATGAAATCAGAGAAGTAA
TACATTTGCCAGAATAAAACCTACGATCCTTTCTCTCACACGGTACACCCACATCAGGTA
TTGTAGACTTAACACTTCGAAATTGAAGAAGCAGCGAAAAGAGATAAGTTTATCAAGGAT
ACTCAAGAATATAATGAAAGCACAAATGCAAGTCACATGTTCTTCGAGATCTTTGAAAAG
AAATTTGATGTCGTCAGTTAAAAAGCATACGAGCCTATGACAAACGAAGACTACCAGAAA
TTCAACCACGGATTGAAACTTCGCATAAACGACTTTATCTCCCGTTTATTCTTCCCCGTG
ATCAAGGCCAGCGACATCTCCTTTGAATACGTGCATCACATGTATGAGATATTCCCCAAC
CATCGTCTTCACACTGAGTTGATATGCAAATGCTTAAATGTACTTAGTGAAATGGCAAGC
TCACAAGAGGACATGTATAAATTCTTCAAAGAAAGACAGCAATAGTTCTTCGATTAAACA
CCAGCAGGTGGTGCTTAAAATGCAAGTACTACTGGCGCTGCAACTGATGGTCCATAGACT
GAGTCAGCTCCTAATAACAGTCACCTGCAACGTAAGATCGACTTGTATGCAGTTGAGATC
AAATCACGCATGATTGCAGTCTATTTCAAGTTTTTCCAGAGAGAAGAACAAAACATCTAC
AAACAAGCCAAGAAGTGCTTGAAACGCCTCCTCAGGAAGGAAACTAACCAGCAAGAAGCA
CTCCCTAATTTGATTCTGAAGGAATGCGTGAGACCATCCCTGAACATCCTTAGTTTAAGA
GGTTCATTCCCTGCTCTGTATGAGTAACTAGCCAAATTAATCAACGTCCTGCACGCCTGC
TTCAACGATTAACTGGGCAGGCACTTGATCAAATGCTATGAGCAGAACAAGTCCAAGATT
ACAGATGAATTTGTATTCTCCTTCACTCCCAGACCAGAGAACATTCAGCAGAGCTCAAGC
ACAACTGGAGATTAAATTTAACAAAACTTTTAGATGCCAAACGGTCCTATACCTCCTTTC
CAACCTGACCCAGAGGCCACACCTGAGATCTAATAGCAGCAGAGATAATAGAAATTCAAT
GAGGACTATGAGAGATTGCTCATGCAGCAAAACCAAAAGATCGAAGAACTTGAGATCGCG
AATAATATTATCAGAATCCTCTACTTGCTGCCAACAAGCAGATCAGAAATCTTAAGAATC
CTAATGTAAATCCCTGACTTTGAATTTTAAGTCTTGTTCGAGCTTGAACGCAAGTTTGAA
GATGCTTTCTAGAGACTTCTTGATCACTATCAAATCAACTACTAGTTCAATCACGAATAG
AACATCAGACCTATCTCAATTAGATTGGGAATCTTAAAGAGTGACTTTAGAGTGGGTCTA
GCCAAATATTTCAACAAAAGTCCCTTAGAAGCTATCGGCTCCTTCCAAAACTTGAAACTT
ATGCCAGTCATGCTTGACATCATGGGTGAGCCCAGCTCTTACTCACTAAGAGAGCGAGTT
TCTAGAGAGTCAGAAGTGTTGAGGACATTCTTGTCTTAAGAGATTGAGACTTCACAGTTT
GAAGTCGGGCTGAACCTGATCTGCATATTCTTAAAATACAATAAGAGCTATCTTTCACTC
AACAATAACTACTAACTAGTTGATAAACTTCAGGAAAAATGGAATGAGCTTGGCAACTTC
AATCCAGAGTCCTTGCTCTAGAAGAGTGGTGGCCCAAATTAGTTCAGAAACCAGTCACAT
TTGAGAGAAATCTACATGAAGATCTAAAAGTGTCTCCTCTGTTACTGCAGAAACCACAAA
TCAAAGCTTTCGATCCTATTCGATCTAATCAAGGGCTACAGATATCAATCAATTGTAGAT
ATGACAGCCACAAAACTATTCTTCCTCTATGAAGTGCCTTACAACTTTCCCCTCTAGAAA
AAGAGACAGCTACTAGATCAAACTTTGAAAGAAATTCAGGCAGGATAGCATACTGATGAA
TAGAAGTTTATGATATTTGAGCTTGCATTTATGCCATCAATCATCATGCACTCAATTAAA
GGCAATGACTAGCATTTCAAGGAAATAGTAGACCAAAAGCTTATGCAAGACTTTGTTGAG
ACTTTCTTCGGAGTAAAGCTGATCGAAACTGAAAATGGGTCGCAGAAGATGCAGCAGCTT
GAATGTTTGAGACAAAAACTAGAGATCTCCCTCTGCGTATCTTATGAGTAATTCTAGATT
GAAATCATTAAGGTCATCAATCTTATGTTCAGATACTTCGATTTCATCACTATCCAAAGA
ACTTGCACATAGCCAGAAGTTTAAAAGATCTCTTAATTCTTATACAATTGTTCTAAGAAG
GCCAATAATCCTAGCCTCAAAGAATGGGCTTTTTACACTTTGACATCTCTTTTTGTAATG
ATTCTAGATGCCAGTCAATATGAGTAACGAATGAATTTACCTCAAACCTCAGCAGATAAT
CAAATGCTTCAAATGATCGCTTAATGCACTGAGCAGGTCTTGATGATGATTATGCAGCAT
AGTTAGAATCTAAACGTAAAGGCGCTAGTGCACAAATCTTTCAGGAACATAATGAACATT
TTCTCCGACCCAAAGATCAAAGACAGAATTTCAGGGTCAACTTCATCGAACAACCAAATC
GATTATGTTTCGCTGTGCCTCAAGAAGGCCTTGATATTTGAAGGCAGAAATACAGCCAGC
ATCATTTACCTTTCAAGTTTCTTGCTTGGACATCAAGAGCAGTTTTACTATTCACATGAG
CAGTTCTTCGGTAGAATGAACAAAATTATCTCTAGATTTGGAGCACAATTGCAGCCAAAC
CTTACTCAAAAGCAATTGCTAGTTGAGCTCTCATCTGTTTTGATAACTTGGATAAGCCAG
AGAATAATGAACATCTAAAGGCAGGGTGCCATCACTGATTAGCAAGCATAAAGCTACCAG
AATATCTTCACAAACATACTGTTCTACTTAATAAGGACAAGTGTCATGGTTCAGTTCAAT
CAAAATGAGCCAGTCAAAGATGTGCTTGATCTGTCAAACTACTGCCTGAATCAAATTAAG
AACTTAGTGAGAGTTTTCCCGAATGTGCGCATATAGTTCCCTTTCTTCAATAGACTACTC
CAGCAAGACGGGGGAGACAAGGAGACCATCTAAGTGATAAAAATGGCAATCTTGAATGTG
TCCTACATCTTGATAAAGTACCAGCGACATGTGCAGGACTTCAAGAGCTTCTTTTTGGAG
TACATCGTCAGCAGCAACACAAAGCACCAGAAGGGCATACTCTACACTTGCAAGATACTC
CTCCACATGATCAGTGCCAACACAGACCCACAGATGCAAGCGAATAAGAATGTGAGACTT
AAGTAGTTCGTGTAGAATGACATGCAGAAATGCTAAGAAGAGAATATAGCATTGATCCAA
CATAAGATAAAGGATGTTGAAGACAAGTATCAAATGGAAAGAAAACCAGCTATATTAGGT
TTCTAAGATGTAGCACAGATAATATCAAATACCATTCCGCACTTCACAATTCGATTGATT
GCAACTATAGACAAATCCTTTAAAGATTAAGGTGTGACTATGCAGTAGAAAAATGTTGCT
TACTGTGATGATGAATTCAAACTGTTGAAAGATTTGGCAACCACAATCTTCAGAGTTGTT
GGCTATTTCAGAAAGTATATAATCTTCGATTAGATGGATGTGAGTCCCCAGAAACTTAGA
ATGAGACATAATGTACTGCATTAAGCATGCACAGCCGATACTGTTTACAGCCAGCCAATT
GAATATCATGGTACTCAGTCAAGCCCAGATGAGATCGCTGAACTCAAGGTAGAAGAGCCT
AATTACGATTTGTTCAACAAAGAGACTCTGATGTTGGGACTTCTGCACATTGTTAAAAGA
ATCAAGAAGATGCCTCAAGAGCAGTCTATTTAGATACTTGAAATAGTCCAGTATATCATT
CAGACATTGATTAAGTACAACACTAATGAATACATTATTGAATGGCTAAGAAAAGTAGTT
GATGAGCTTATTGACGACGATGATCAAGATGTGTCGAAATTAGTTATGGAGTAAAAGGCA
AGCTACGTAAATAAGATCCTTTCAAAGATTCAGGATATTCAAACACCCGAGAGAAAAGAC
ACTGCTACAACCAATTAGCTAATTGAAAGCATTTTTGAGTAGAGCATCCGATTCTTGGAG
AAGCAGCATACCTTTCTTAACGAGCATACCGTAAGACTTTTTGAAAAGATCTTCTTGAAC
TTGAAAGGAAAGTCAGTCCCATTGAAGCAAAGAGTCTTCAAAATCTTTGAGAAGCTACAT
GGAACACAGCTTTTCAAGAAGTTACAGTTTTTCTTCCACAAACGACAGTTAGAAGATGTA
GATAAACTTCAGTTTTATCAGAGCCAATCTCAGCTGCTCGATTTCACACTGTTTAACTTC
AGAACAGATACACCTTTGACCAAGAGTAAATACTCATCGAGGTTGTTCCCACTGTATAAT
CTTAGCATTAAATTTGAGAAGTAGGTTTCATTAGAGGAAAATCCATTGAGAGTCGCAAAC
TCCGAATATAACAGACTTTCAACACATTTACAGCAGTTTTCAGAGTGCGTTAATAAATAC
AGCTAAATGAAGTTGAAAGATATCATGAACCCCATTTCAGAGATAATCAGTATCAATCCA
AGCCACAGCACTGATAAAAACATCTCAGATAAGCTGTTTGTGAAACTGTTCTACTAATAC
TGGAGTATCCAATCTCGTGAAGAGCAGCAAATCTTAACAGAATCAATAAACCAATTCTTG
ATCTCTACTATTCCACTGATAAGCAATCAGGATTTCAGAAAGAATGTGTTCCCCAAGACC
TTCTTAGAGTCACTTGCCACCCTGAGCCCTCAAATTAGAATTGAGCCCGAAGTCTTGCAA
TATCTGGGTAAGAACCTAAATTTGTGGCATGTGTCTATCCCAATCTTAGAGAACCACATT
AACCTGTACCCAACAAATGAAAGATACATCTTCTCTTTGAATGAGATGTATAGCAAGCTA
GCTGAAGACGATTACATTGCTGGACTGAGGAGAGTAGTAACTGAGGCAAAAGAAACAAGG
TCAATAGTAAGCTATGGCTAGCATCAAATGTGGGAAGAGCTCAATTAGTAGTTCAGTCAG
TTTATTATCTATCACGCTGAAGAACAAGGTCTCTACTAACAAATGGATTAAGATGTAGGA
AATCTAGGGAAATATTAGAGACAGCTGCAACTATCAACTTATAAGCATCTTAAGGACAAT
CACAAAGATCTATACAGGAAACTTTTAACCGATCGTGCAGCAGCAAGTGGCTAGCCAATT
GATGAAGCACTTATTAATACTGAAGTTGAGAAAGAAGATGCAAGGCTTGAGAATAGCATT
TCAGATATGGCTTTGATGAGCTAACAATAGAATCAAAATAAGCCTGGCAACAAATTAGAC
ACTAATAGATTTAAGGAGATGGATTTGAGAATTTGGGATAATCTTTTTATTGAGAGTCTC
AAGGTGCTTAACAAATGGGACCAATACAGAGACATCGCCCATGCCCTCTAGAACCAAGAA
ATGCTGATTGAATACTACTGGAACGTGAAGGACTGGAGAAATCTGTCTCAGTACGAGCAA
ATCTTGAAAAAGAGTGAGTCAATCAAGTACCAGATCTACTACATCTACTTCATAATCTAT
CAGCAGCACATCGCACAGTTTGACGAAATGTTCAAGCAGGTCATCCATCTCTCATTCAAG
GAGTGGGATTCCTACTTGCCCAACTATATCGACAATGTGCAATTCGAGAACCTGATAATG
TTCCAGCTGGTAATGGAGACCTCTGAAGGCGGGAGGAACATGATAAAAGAGGCTTAAAAC
ATGAAAAACAGAGGGAAACTCGGCGACTTGAAGACAGCCATCAACATCTGGAGAGAGAGG
ATTCCCAATAAGTGCGAGAGCATTCAAATGTGGAAGGAGGTCCTGGAGAACAGAAATTTC
ATTCAGCATCAAATCAGTACTATACTTTGTCCAAGCCAGCCAAATATCACCCCAGCTATG
TCACAGCAAGATGTGATGTAATAGAAACTGCAGCTAGAGAGCCAAAGACAGTAATTCGTG
AATGAATTCTTGGACATTTCTTGGAACTACTATAAACTTGTGTAAATGAGCAGGAAGCAA
GGCCTCCCCACTCTCGCCTACAACTACTGGCAGATTATGCGGAAATAAGTAGCCTAAAGC
GGAGACAGCGAGGGCGTTAAATTTGAAAGGTTCAAAGTGGACTACGAGGATTTGAAGATC
AATCTGCAATTCAATACTAATAGCAAGTCTTTGGAATTGATTGTGTAGAACTATGTCGAT
ACCATCAACAGACGATACAATCAAGAGTAAAACTTCGAGCCTTGGCAAGCAGCTGAGATG
GATCGCTTGATTGGAGAGTACTACCTCAAACAAGGGCACTTGGGAGAGTCTCAGAAGTAT
CTTACAAGATCTATTGATTTAAACAAGAAAGAATCAAAGACTTGGTTGAGCTATGCCAAG
CTTAATCAGATAGTCTTTGAGAACAAGAGAAGTGAGGTCGCTCTATAAAATTGCATCAAG
GGTTACCTATCAAACATAGCTCTCGATCTCCCCAAGAGCAGGCTTGTCATACCTTAAATG
ATGAAATTCCTGAAGAGAAGAGACATGAACAGCTAGCAGTACTCTCCGGTGGTAAACTAT
ATTCGAGTCAATCTTGATTAAATGCCCACTTGGATCTGGATATTCTGGCTACCACAATTG
CTTCACGCCTTTTGCAAGTATTAAAACGCAGTGGAATACTGTTTGGGAGCTAAAGCCCTG
GAGAAATTAAGTAAATAATATCCTTAATCACTTTACTATCCCCTCAAGTCGAAATAAACC
ATTGAAGAAATGAGTGCTAACTAGAATACTTACCTAAGAATATTCTTGAAAAATATTCAA
AGTCATAGCAACTAGCAAGTCTTACATTTCTCAGATAAAATATCTAATGAGCTAACTAAG
ACCATGAAGATGTCTGTTGAAGAAGAAATGTACACTCTACTTAACAAGATACTTCACATA
TCATCATTCTTTAAAATAGATAACTTCGAATAAGACTTCCAAAACTTCCTAGCATAAATC
AAAGATAGATATTTACGAGAAGAAAATGTTGCTAATTCAGTAGTCCTACAGTAATTGAGA
TAGATTCTGATTAATGATTTCTTGAACGAAGAGACTAAGGAGAAAGAAATAACCGAGATC
ATCAGAAGATTGAAAAATCTGAAAGATTTCCTGCATAGAAAACTTAGTCTTGCTGAGTAA
AAAACTAACTTAGAACAGATCAGTCCCTACTTGGCTAATTTCAATGAAAAAGGAGTAGAG
CTACATGGCTAATATATGGTAATTGACTAGGAACCATAACCACAGAATACGATTTACATT
TAGAAGTTTGAACCAGTTATATACCGAAGTGGAGTGACAACAAAGAAAATAGTCATTAAG
GGCAGCAATTAGAGAGCTTATGGTTTTACTATAAGCTTCGTCTCAAATAAAGAAGAGTGC
TTGAAACATTTCTAAGATGAAAGAGTGCTTCAGATAAAAATGATCATGAATCAAATTTTC
TAAAAACACAAGGAGTCTATAAGAAGAGGTTTAAAGTTTAGTGTTCCTATCAAATGTTTG
TTACAAAGATGCAAGCTAACTTAAGATGACAACCAATTTGGTTAAATGATTGAGATTCAC
GATTATCTTCTATAAGAGAGAGGATTAGACTCTGATCTCGCATTTAACATTCAATTGAGG
AAAGTTAAGGAGGTCTTTGAGAATTACGAAGAAGGGTAAGAGAGAACAATATCTAGTCTG
TCTGAAGAGAAAAAGAAGCAGATAATTGAAGAGACTTACTCAGAAATGAAAAATGTTTAT
TGCCAACCATACTTACTTAGTTCATTCTTCCACAGAATCTTCTACACAGTGGACGACTTA
TTCATCTTTAAGAAGCAGTTCACCACTTACCTAGGTGTCAACTCCTTCTTCTCCTACATT
TTCACCCAGGCAGAGTACGCTACACTCAACCAGATATCTTTCTGCAAAACAAGCGGCAGA
TTGATGTTTAATGATAATAAACTGAGTGAATTCCTGAAGTTTATGAAGTTGCATTACAAT
CAGATCGTCAGTAGCAAGCAGCAAATGGGTGGCTCTGAGATTGACATGGATTTCTTTGAT
TAATTCGAAAAGCAAGAAATGCAAAAGTAGAGCAGCTACTTACCATTCAGATTGACAAAT
AACATCGTGGATTTCATTGGTAAAATAGGTCTGCACGGGCTCTTCGCTGGTTCAATGACA
GCCTGCTCCCTGGCACTCAGCAAACACCACGACAAATTCCTACCGCTAATCTACATAATG
TACTTGGATGAGTTCAATGGGCAGAAGGAGGGCATGATCCACTTCATAAACACCTGCACA
GACTACTTGAGGTTCAAGATCACCAGTCTATCGCAAAACAAGAAAGTCATACAATACGGC
TAGTAACCACAACCGAGATAACCATCCAATATGAATGTCAGTGGTCAAAATGAAGATGGA
CAGCAATAGCAAAACAATGAAGTGGATGGAAGTGTGTTTGCTGACTAAACAAACATGATG
AATCAATAGCCAGCACAGTAAATGCCTTAAGAGGAAGTTAAAGACGACTGGAATGACACT
ATTCCAATCGGATAGTATGAAGTCCCCAAAGCCTACCTCAAATTTGAAATTGAGAAACCC
AATATCTTTGAGGAATTTAATAAGAAAGTGTTCGATTTGATGGACATCGCTATGGACGAC
AAGAGACTCAGCCAAGTCACTATGACTCACTGGAACGCCTGGTTCTGA


>Contig22731.0.g86(protein)
MNTGINIPSMDDSQRVQTLLQQLRTIKNNEPEYLRLLHEVIEYMEYLQQPMNQQATLTNF
QSIIIPEIVNIMNEKEPTMVDNIRHKIRRYSLEILLIVPFPDQRENIPCEEIIKLIIDVL
LNDNEENAELAIKILLEILKFYKTNWDALENYYIQFIQYCTQLFQNLPSKLQEIKQVDDS
GAPINRLNQSQDEQVLTPSTKSMKNISLVTHYLIMLNQIFDQKLKPYILQLLDVIFPALR
QFPDKILPEVKNMSIYMEFLDILKNILSFFTFIFKKSYTEEILDNLDTIIGLQFKILKNT
PQHGQWIRKDILHMIKYEIQETTAFERADRTQGYQGREHLYKKRNECLQNYLDDFLDVNT
IFGKGKLTKELQYYGRSLIVTYISQFRDPMTEAQLKKCLHTIIKIILDPSISFVMRSTYI
FLLFRKYEELYSKTQQNQNYINPHCELQLEILEALVMMMKELDSHIKIATDEMVSFKEQV
ISLRKSSKKWMNDIEQRDINFKELFLQDDYQFYEVGKQDPIEVDKVRIQYLFNSFFDTNS
SLSQSQQHEINRDKLKYQAFISLTDQQLNEYLDAQKENTLKLVRNITTIIDTILLNIQET
RRTKCLRLPEMKLMRKLLISGSRIIQSLYEMFTVDKEKVNDLIKKFAKIFQQMRVLQFRD
LFSSVEDEFFGYVIEVKATKGDSGVYLFADYLMSFQQNQPNQMPNPINKHLDDQAAYMLE
IFYGYINSKMRIFNKAMETEPILSMNEADQRFAKIATPDLQDALQKLTLAIGSKALSKRN
DLRMKNLFFSVFVFCVKCTKSSRIIPYYYSVIRNLFKELNLTTINDNSNFVKEFIPLMQG
LLETFLQAKDEAPFIKETNEICYSVPAKLKNLIEYLPIVSRPLIDSMKSNNIELIESGIN
TIQIWVSALGNYPEILDPVIDSIIPELNSLLYKILYLFPNYSFKLLGKFGAKSRMYNEDK
EFKSKNYPEDGLKIDLEDKSSGKQISLGIDTAIDVVLLKIFDSFHKFNHAKLLEAYKLIK
GAFICFIEPQFDMDYIIASIANAKVKNTDLLTQYNMNSAKYFDTKQTQIKVSALGKASES
HAFEKILKCLLIACSLPKDNPETKVVHGKVKKFFKWVTQYFTLIYICKNGKLRENLVNEI
SPLVFMENICDFLYFNLVQGMPKSQNRSYHKGSITALKTMIRMIKDFYGEEDDQIYENLE
FIQYLIQKICHLAYGHDMPKKVAANRALQIIIQELPRRTIKYHWQTLVDSVFHVLVTNND
SLVYQVEKECRSTLDLFIGKIGLYTKNILDTIDDSEKDFYSAVLDRVLVNIVQSRNSARH
IGQFFIEEISKKTGHSVKSILLRVNCNVYVGQLLQQQQQQQQQQYQQQLQQYQQQQQLLQ
QQLQQAAAGGSQPQPQPQSNPISAPQQPKPITSAQIIGSQDVSWSAYLTLSQVENRAKQI
YPLFKGGYTQVQHLVTYLDIIEFCLKHQVLDPIGKVHIYLAICEQLIKVLEDEIEKHEPR
AKTGTGANAPEQEQPSSFANDPMVSNAAKAAVKYMKSEKQYICQNKTYDPFSHTVHPHQV
LQTQHFEIEEAAKRDKFIKDTQEYNESTNASHMFFEIFEKKFDVVSQKAYEPMTNEDYQK
FNHGLKLRINDFISRLFFPVIKASDISFEYVHHMYEIFPNHRLHTELICKCLNVLSEMAS
SQEDMYKFFKERQQQFFDQTPAGGAQNASTTGAATDGPQTESAPNNSHLQRKIDLYAVEI
KSRMIAVYFKFFQREEQNIYKQAKKCLKRLLRKETNQQEALPNLILKECVRPSLNILSLR
GSFPALYEQLAKLINVLHACFNDQLGRHLIKCYEQNKSKITDEFVFSFTPRPENIQQSSS
TTGDQIQQNFQMPNGPIPPFQPDPEATPEIQQQQRQQKFNEDYERLLMQQNQKIEELEIA
NNIIRILYLLPTSRSEILRILMQIPDFEFQVLFELERKFEDAFQRLLDHYQINYQFNHEQ
NIRPISIRLGILKSDFRVGLAKYFNKSPLEAIGSFQNLKLMPVMLDIMGEPSSYSLRERV
SRESEVLRTFLSQEIETSQFEVGLNLICIFLKYNKSYLSLNNNYQLVDKLQEKWNELGNF
NPESLLQKSGGPNQFRNQSHLREIYMKIQKCLLCYCRNHKSKLSILFDLIKGYRYQSIVD
MTATKLFFLYEVPYNFPLQKKRQLLDQTLKEIQAGQHTDEQKFMIFELAFMPSIIMHSIK
GNDQHFKEIVDQKLMQDFVETFFGVKLIETENGSQKMQQLECLRQKLEISLCVSYEQFQI
EIIKVINLMFRYFDFITIQRTCTQPEVQKISQFLYNCSKKANNPSLKEWAFYTLTSLFVM
ILDASQYEQRMNLPQTSADNQMLQMIAQCTEQVLMMIMQHSQNLNVKALVHKSFRNIMNI
FSDPKIKDRISGSTSSNNQIDYVSLCLKKALIFEGRNTASIIYLSSFLLGHQEQFYYSHE
QFFGRMNKIISRFGAQLQPNLTQKQLLVELSSVLITWISQRIMNIQRQGAITDQQAQSYQ
NIFTNILFYLIRTSVMVQFNQNEPVKDVLDLSNYCLNQIKNLVRVFPNVRIQFPFFNRLL
QQDGGDKETIQVIKMAILNVSYILIKYQRHVQDFKSFFLEYIVSSNTKHQKGILYTCKIL
LHMISANTDPQMQANKNVRLKQFVQNDMQKCQEENIALIQHKIKDVEDKYQMERKPAILG
FQDVAQIISNTIPHFTIRLIATIDKSFKDQGVTMQQKNVAYCDDEFKLLKDLATTIFRVV
GYFRKYIIFDQMDVSPQKLRMRHNVLHQACTADTVYSQPIEYHGTQSSPDEIAELKVEEP
NYDLFNKETLMLGLLHIVKRIKKMPQEQSIQILEIVQYIIQTLIKYNTNEYIIEWLRKVV
DELIDDDDQDVSKLVMEQKASYVNKILSKIQDIQTPERKDTATTNQLIESIFEQSIRFLE
KQHTFLNEHTVRLFEKIFLNLKGKSVPLKQRVFKIFEKLHGTQLFKKLQFFFHKRQLEDV
DKLQFYQSQSQLLDFTLFNFRTDTPLTKSKYSSRLFPLYNLSIKFEKQVSLEENPLRVAN
SEYNRLSTHLQQFSECVNKYSQMKLKDIMNPISEIISINPSHSTDKNISDKLFVKLFYQY
WSIQSREEQQILTESINQFLISTIPLISNQDFRKNVFPKTFLESLATLSPQIRIEPEVLQ
YLGKNLNLWHVSIPILENHINLYPTNERYIFSLNEMYSKLAEDDYIAGLRRVVTEAKETR
SIVSYGQHQMWEELNQQFSQFIIYHAEEQGLYQQMDQDVGNLGKYQRQLQLSTYKHLKDN
HKDLYRKLLTDRAAASGQPIDEALINTEVEKEDARLENSISDMALMSQQQNQNKPGNKLD
TNRFKEMDLRIWDNLFIESLKVLNKWDQYRDIAHALQNQEMLIEYYWNVKDWRNLSQYEQ
ILKKSESIKYQIYYIYFIIYQQHIAQFDEMFKQVIHLSFKEWDSYLPNYIDNVQFENLIM
FQLVMETSEGGRNMIKEAQNMKNRGKLGDLKTAINIWRERIPNKCESIQMWKEVLENRNF
IQHQISTILCPSQPNITPAMSQQDVMQQKLQLESQRQQFVNEFLDISWNYYKLVQMSRKQ
GLPTLAYNYWQIMRKQVAQSGDSEGVKFERFKVDYEDLKINLQFNTNSKSLELIVQNYVD
TINRRYNQEQNFEPWQAAEMDRLIGEYYLKQGHLGESQKYLTRSIDLNKKESKTWLSYAK
LNQIVFENKRSEVALQNCIKGYLSNIALDLPKSRLVIPQMMKFLKRRDMNSQQYSPVVNY
IRVNLDQMPTWIWIFWLPQLLHAFCKYQNAVEYCLGAKALEKLSKQYPQSLYYPLKSKQT
IEEMSANQNTYLRIFLKNIQSHSNQQVLHFSDKISNELTKTMKMSVEEEMYTLLNKILHI
SSFFKIDNFEQDFQNFLAQIKDRYLREENVANSVVLQQLRQILINDFLNEETKEKEITEI
IRRLKNLKDFLHRKLSLAEQKTNLEQISPYLANFNEKGVELHGQYMVIDQEPQPQNTIYI
QKFEPVIYRSGVTTKKIVIKGSNQRAYGFTISFVSNKEECLKHFQDERVLQIKMIMNQIF
QKHKESIRRGLKFSVPIKCLLQRCKLTQDDNQFGQMIEIHDYLLQERGLDSDLAFNIQLR
KVKEVFENYEEGQERTISSLSEEKKKQIIEETYSEMKNVYCQPYLLSSFFHRIFYTVDDL
FIFKKQFTTYLGVNSFFSYIFTQAEYATLNQISFCKTSGRLMFNDNKLSEFLKFMKLHYN
QIVSSKQQMGGSEIDMDFFDQFEKQEMQKQSSYLPFRLTNNIVDFIGKIGLHGLFAGSMT
ACSLALSKHHDKFLPLIYIMYLDEFNGQKEGMIHFINTCTDYLRFKITSLSQNKKVIQYG
QQPQPRQPSNMNVSGQNEDGQQQQNNEVDGSVFADQTNMMNQQPAQQMPQEEVKDDWNDT
IPIGQYEVPKAYLKFEIEKPNIFEEFNKKVFDLMDIAMDDKRLSQVTMTHWNAWF