Identifiers and Description

Gene Model Identifier

Contig19735.0.g24

Standard Name

TRNT1

Aliases

Contig19735_0_g24

Description

Poly A polymerase head domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam01743 ) Poly A polymerase head domain
  • ( pfam12627 ) Probable RNA and SrmB- binding site of polymerase A
  • ( pfam07951 ) Clostridium neurotoxin, C-terminal receptor binding
  • ( pfam13735 ) tRNA nucleotidyltransferase domain 2 putative

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYER168C1.0003180480544985e-86CCA1 SGDID:S000000970, Chr V f
rom 522669-521029, Genome...
T. thermophilaTTHERM_005010001.999469658314961e-75polyA polymerase family protei
n

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19735.0.g24(coding)
ATGCAAATTATAAAAGAGAATAATCTTAAGACCACTCTTAGAGTTGCAGGAGGTTGGGTC
AGAGACAAGCTAATGGGAAAAGAGAGCATGGATATCGATATCGCACTCGATGATATGTTT
GGAGAAGAGTTTGCAAAGATGATAAATGAGAAGTTGCATCCAGATGGTGCTAAGAAATTT
GGAGTTATAAAATCGAACAGCGAAAAGTCCAAGCATCTTGAGACTGCAACTTTGAGAATT
CATGGTGTTATGATTGATTTAGTGAACCTTAGATCAGAAAAATACACTGAGGAGTCAAGA
GTGCCAACTATTGACATTGGAACGCCTGAAGAGGATGCTTATAGAAGAGATCTTACTATA
AATTCACTCTTTTACAATATAAATGAATAAAAAGTGGAAGATTTTACTCAAAGAGGCATA
TAAGATTTAAAAGATGGTATAATCAGAACACCTCTTGAACCACTTCAAACATTTTTGGAT
GATCCCTTAAGAGTTATGAGAACTGTGAGGTTTGCTACAAGATTTGATTTTAAGATTCTT
GATGAAATTTATGATGCAGCAAAAGACCCAAGAGTTTAAGTAGCATTTTCCTAGAAGGTA
ACATATGAAAGACTTGGCAAAGAAATGGATTTAATGCTCCTAGACAGACACCCATCTAAT
TCTATTGAGTATCTTTACAACTTTGGAATTATTTAGTCCCTTTATAAATTACCTACCTCA
TGCAAAGAATTGACTGATGATTTACTAGTGAAAAAGCACATATTTGAGTCTTTGAAGCTA
TGTCAAGTTCTTGGAGCCTTATTCATAATTTTGAGATAGCAATAAGGAATCGTAAACTTT
GCTGGCTTCAACTATTCAGTTTCTAGCGAAGGGGATGATAATGGAAAAATTTTGGAATAG
TTCAAGGAATTTTAAAAGAACACCTTTTATGCTGCTTTGTTGTTACCTTTTTACCCATAT
GATTATCCTGCAAAAAACAACAAGCTTGACAAGGTTATAAACAAAGTAATGTTTGACTCA
CTTAAAAAATCCAATGAAGTCATGAAGTTTGTGTAGTAAACACTCCCTCATATTGATTAA
GCCAAATAATACAGCGATTAAGTGTCATAGCTTGATAGTCTCGATGAAGATTTAAAACTT
AAACTGGGTTTATATTTAAGAGAAGCAGGCTTTAGATGGGACTCTATAAATCTCATAGTA
ATCTCTTAAGAGTACTACAATAACTTTATTAAAAGTTAAGTTGATAACGGTGATCTAACT
CAAATATAAACTCTCATAGATCAACAAGGACTATAGAGCATTATTCAAAAATACCAGCAT
TTAAATCAAGTCATTGAGAAAGAAAGTTTAAGAGAAACTCATTTGTTGAGATCACTACTA
GATGGGAAAGATGTGTGCGAATTATATAAAATAAAGCCTGGAAAATCTTTGAAATTCATC
TTGGAAGAGCAAATCAAGAGACAGATTACACATCCAGAGACTACCTTTGACATGATGAAA
GAATACTTGCTTGAAAAGAAAGATGAGTTCCTCTAGAAGTATTAATGA


>Contig19735.0.g24(protein)
MQIIKENNLKTTLRVAGGWVRDKLMGKESMDIDIALDDMFGEEFAKMINEKLHPDGAKKF
GVIKSNSEKSKHLETATLRIHGVMIDLVNLRSEKYTEESRVPTIDIGTPEEDAYRRDLTI
NSLFYNINEQKVEDFTQRGIQDLKDGIIRTPLEPLQTFLDDPLRVMRTVRFATRFDFKIL
DEIYDAAKDPRVQVAFSQKVTYERLGKEMDLMLLDRHPSNSIEYLYNFGIIQSLYKLPTS
CKELTDDLLVKKHIFESLKLCQVLGALFIILRQQQGIVNFAGFNYSVSSEGDDNGKILEQ
FKEFQKNTFYAALLLPFYPYDYPAKNNKLDKVINKVMFDSLKKSNEVMKFVQQTLPHIDQ
AKQYSDQVSQLDSLDEDLKLKLGLYLREAGFRWDSINLIVISQEYYNNFIKSQVDNGDLT
QIQTLIDQQGLQSIIQKYQHLNQVIEKESLRETHLLRSLLDGKDVCELYKIKPGKSLKFI
LEEQIKRQITHPETTFDMMKEYLLEKKDEFLQKYQ