Identifiers and Description

Gene Model Identifier

Contig15383.0.g27

Standard Name

TRN1b

Aliases

Contig15383_0_g27

Description

HEAT repeats

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005271102.0009803861620222e-78Importin-beta N-terminal domai
n containing pr...
SGDYBR017C1.999385218781115e-51KAP104 SGDID:S000000221, Chr I
I from 273703-270947, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig15383.0.g27(coding)
ATGCAATCATTCTTTGATCCAGAGTATACTGTCAGGAAAACAGTTAGCTCTGTAATGTCT
ATTTTGATAGTGAAAGGAGGCTTCCACATTTGGCCAGAGCTTCTTGGATTTTTGACAGAA
AACTTATTAAACACAGATACCTCTATTGTTGAAAACTCAATACAAGCCATATCTATCATT
GTTGAGGACTGTGCTTAACTATTTGAAAATGAAGAATATTACTAAGTTATTTTAAATATG
ATCCCGAATATTTTTCGACTTTTGGACTTAAATTAAACAGAAAATGTTAAACAACATGCA
ATAAATACGGTGAACATTTTGTTAATGACTTAATCTCCAGCTGTTTGCAACCATCTTGAA
AGTTATGCAAAACATCTATTAACCATGTAAGTTGACCCCTCCCCTCAAGTTAGATGGAGA
ATAATCTAGGGCTTGAATGCTGTCCAGGAATTGAGAGTTGATATCATAATGCAGATCTTC
GATTAAGTATGTGACTTAATGATAAATGCACTCAAAGAGAATGATTAAAAAATTGCATTG
GCTGCTACAGAATTTTGGTCTGGAATTGTTTCACAAAGATGTAATACACCATAAGAGGAG
GAGCTTAAAGTTTAAAAAATATTTCATAAATTACCCATCCTTCTTGCTGCTTTATTTGAA
TGTTGCAGATTTACAGAGTTTGACAGAATGGCTCTTATGCCAAGCAAAGATAATGATATT
GAATTTGAAAAAAAGAATTAAAGCTAAGATAATTTTGCTGAAGGAGAGGAAGAAGATTAT
GAAATTGGAGATGATGAATATTTTACAACTCTTAGGAAGTCTTCTGCATTTACTATTGAA
AGATATTCAAAAATTTATCATGACGAATGCTTTTTTATGCTTCTTCCACATTTGGAGACA
GCAATGAAAAGCTAGAACCCTGACTTAATTGAACCAGCAATTTTGGTACTTGGTGCAATT
AGTGACTCTGATGGTGCTTATGGTGTCATAAAGATACATTTGGATAATTTAGTTCCATAT
CTTTTGGAAGCCTTGAATTCTAACAACGAATTAGTAAGATCAACAACTCTTTGGACTTTG
TCAAAGTTTACTGATTGGATAGCTCAAAGCGATAGGTATATGGAAATTTATATCAATAAT
CTATGCTAAAAGATGATTGATAACGATCAAAACGTTCAAGAAGCCGCCTGCGCAGCATTA
GCAGTTATAACTGAGAGTGCTCCAGATAAACTATTACCACATATTCAAAAACCCCTTGAC
GCCTTTAAAATGGTGATTGACATTTATAAAGGGAACGCTTTAGTTCTTTTACTAGACGCT
ATAGGATAAATGGCTTAATCCCTAGGTGAAAATATTAGAAATGAATCAATTATATCATAA
CTAATGCCAATCTTAAATAAAAAGTACATGGATATAGATGATGAAAGTAAAATCATATTC
CCTCTATTTGAATGCTTCGAATCTGTCGTGTCCGCCCTGGGTCCACTTAGTGAACCATTT
AGCAAACCAATATTTGAAAGATGTGTAAATATCATTTAGAAATTCATGAATAAAGTTAAA
GAGGATCCAGATTCACTTTTTACTGAAAGCGAATATTTTGTTGGCTCAATAGACCTCATA
AGTTTTCTATTTAGTGCAATTGGAAGCAAAGCTCAGTAACTTGTTGTTCAAACTAATTTC
TTAGCTATGCTTTACGAATTGCTTTAACTAAAGAATAACTTGGTTAAATAGTATGTTTTT
GCTATGCTTGGAGATTCCTAAAAATACTTAGGAGAATTATTTAAACTATGCCTTCCTCAA
TTTATTCAAGTAGCCATTGATCACCTCATTTTTAATGACTCTCCAGAGTACGATAAGAGT
TTCATGACTGTATGTAACAATGCTTGTTGGTTTTTAGGTCAGGCAATAGATAGCCCTAAT
AGCGAATTAGTTAGGCCTTATATCCCACATATTGTTTAAAGGATTGTTAGTATTCTTAGT
GCTTCTAAGTTGAATAAATCTTTGGCTTAAAACTTAAGCGTGACATTTGGAAGAACTGGA
CTTCTTGAATCAAAAGAAACTGCTGTATATCTAGATAGAGTTCTTAAGTAATTTTGTATG
TCAATGAAGATAATAAAAACTGGGGCAGAGAAAAATTCAGCATTCAAAGGAATATGCTAA
ATGATTCCTCATAATCCTTAAGCTGCTCTGAATGCTTTTCCATATCTTTGTTTTAGCTTT
GTTAACTATAAGGATATACCCTAAGATTTATTCAATATATTCCAAGGCATCCTTAATAGT
TATAAAAACTCAATGGAGTCCTAATGGGAAGAATTCATGGCTAGTCTTCCTTAGGATTTG
AGATAATAATTACTTACAATCTACAATGTCTGA


>Contig15383.0.g27(protein)
MQSFFDPEYTVRKTVSSVMSILIVKGGFHIWPELLGFLTENLLNTDTSIVENSIQAISII
VEDCAQLFENEEYYQVILNMIPNIFRLLDLNQTENVKQHAINTVNILLMTQSPAVCNHLE
SYAKHLLTMQVDPSPQVRWRIIQGLNAVQELRVDIIMQIFDQVCDLMINALKENDQKIAL
AATEFWSGIVSQRCNTPQEEELKVQKIFHKLPILLAALFECCRFTEFDRMALMPSKDNDI
EFEKKNQSQDNFAEGEEEDYEIGDDEYFTTLRKSSAFTIERYSKIYHDECFFMLLPHLET
AMKSQNPDLIEPAILVLGAISDSDGAYGVIKIHLDNLVPYLLEALNSNNELVRSTTLWTL
SKFTDWIAQSDRYMEIYINNLCQKMIDNDQNVQEAACAALAVITESAPDKLLPHIQKPLD
AFKMVIDIYKGNALVLLLDAIGQMAQSLGENIRNESIISQLMPILNKKYMDIDDESKIIF
PLFECFESVVSALGPLSEPFSKPIFERCVNIIQKFMNKVKEDPDSLFTESEYFVGSIDLI
SFLFSAIGSKAQQLVVQTNFLAMLYELLQLKNNLVKQYVFAMLGDSQKYLGELFKLCLPQ
FIQVAIDHLIFNDSPEYDKSFMTVCNNACWFLGQAIDSPNSELVRPYIPHIVQRIVSILS
ASKLNKSLAQNLSVTFGRTGLLESKETAVYLDRVLKQFCMSMKIIKTGAEKNSAFKGICQ
MIPHNPQAALNAFPYLCFSFVNYKDIPQDLFNIFQGILNSYKNSMESQWEEFMASLPQDL
RQQLLTIYNV