Identifiers and Description

Gene Model Identifier

Contig18963.0.g36

Standard Name

TRN1a

Aliases

Contig18963_0_g36

Description

HEAT-like repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYBR017C5.000468829272308e-18KAP104 SGDID:S000000221, Chr I
I from 273703-270947, Gen...
T. thermophilaTTHERM_005271100.0000000000000030004923591262316Importin-beta N-terminal domai
n containing pr...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18963.0.g36(coding)
ATGTTATATTAGAATCACTCGTAATCTTTTGATGTAGAGGATCTCTACTCTCAGGAAAAA
ACATTAATTCTTTCACTAGTAGCATTACTTGTTACAACTGATGATGCATATGAGGATATG
AAGCTAGGAGTTACTAATGTTTTACTTAAGAAATTAAACATAAAATTCGTAGATGCAAAT
TTATCAAACAAAGAGAAGGAGTATCTCGCAAAGACCATCATTTTCGCTCTCAGCTAAAAC
GATGATCCCCATTTAAGGCAGAACATAACTCAGCTAATTGCAAATTTGTTGCTGCCTTTG
TAGAGTAAAAAGAGTACTGACGTGTCAAGGGGGTCTTAATCGAAAAGCGGCAATGGCAGC
AAAGGAGATGTAACAATTGACAAAACATCTGAAGTTTTGTCCGAAATGCTTAAGTTTAGC
AATTTAGATGATTAATCAGCTGATAATTCTTAAATACTTCTTGGTATCGATACAAGAAAT
GAATCTACAAATAGCAACGAGAGAAGAAGTAGGGAATAAAAACGTTCATTGCTCTAATTA
TTATTTCAACAAATGGCTTGTGAGATGCATGCCACAGACGAACGTAAAGCTGAAATTGTA
TTAGACAGTCTTGAATAAATTTTGAATATCGCTAAGTCTTCTAATAACTCATATTTGATA
GTAGAAAACATTCAAGAATAAGACTTCCTGCTTGAATACTTACTTGAGTCTCTAACTTTC
TTAATCTCAAATCGCACAAGTAAGAATTTGGTATAATTGGCAATGTAAGTTACGACTTAT
CTGATAAAACAAGCATCACTCAAATCCTCCATTTCTTGCCTTCTCAGCAACCTTTTAGAG
GTACTCTTCAAGATTGTTCCATCAGAGAATGAGGAGATAATATTAAGCGGCGTACTTTGT
ATAACGGAGATCTTTACTAAGGAGCCATATCTAGTCATAAAAGCATATGAGTCAGGATTT
GACTTTTAGCTATTTTTCAACGCAGTCAAAAGTGCTGACCCAGAAATGGCGCTAGCAGGT
ATCGAATTCTGGTAAAAGTTTATAATGATTGACACTGTCATCTACAAGCAAGACTTCAAA
AAACAATTGTTTGAGTAATTATTGCCTATGATGTTGGACTAGTGCAAATTAAAAAATGAA
GACTATGAGAAGTTTATGAGAGACAAACGCCAAGCTAACGTTTTAGAGAGAAAGAGACAA
ATCACAAGAAAGACCATTAGGTCGAAGGCTGCTCAAACTATAGAAATAATATCAGAGAAA
TTCCAGAAGGAGGTGTTCACATCACTAAAGTCTTAGCTAGAATCCTACATAAATAGCAAA
AGCAATTGGGTTGACAAAGAAGCAGCTATTCTTGTTCTTGGAGTAATCAGCGGTTTTAAA
ACAGAATTTAAGCAGATTGAAGCACAACTTCTAAAACTCGTGCCATTATTGATTGAAGAG
CTTTCGGGGACCAACGCCCAAGTCAAGGCAACTACTTGCTGGACATTATCGACTCATAGC
TTCACTGAGTGGCTCACCACTTAAGAGAACCAGTTGTTCTTTCACTATGTAGACCGACTA
CTGCTTCTCTTAAGCGATGAGGAAAAATCTGTTTAGAAATCTGCACTTTCAAACTTCTAG
CAGCTACTTCAGACTCCAAATGTGAAGAATAAATTAGCTCCAAGACTTAATCTATTTATT
GATGCTTTCACTAAAGCATTTGGAAACGCAGATCACTACACTATGATGAGCTTGAATGAT
GCTATTTATCATTCATGTTTGTGCTTTGGAGACAAGGCCTCTGATCTTGCTTATCAAGTC
ATGCCTTATTTAGTCCAATCCTTCCAAATTACAAGTGATGAGCAGAGTAACTCTATATAT
TCTTTAATAGATTGCTTGATACAAGTGACAAGTGTGTTACAAGGCAGAGTGAGTCAGTGG
GCAGGAGAATTAATAGAGAGGTCTCATCTCATCATAATCACTATATTAAAGAACAAGACT
CAGTTAATCGGCGATCATCAGCAACAAAATCTTAATATTTCTTTTACTGCTCTAAAGGAT
TAGGATAATGAGATTGCCGTCATTCAAAAGATTATTGAGTTAGTCTAGAATGTTTTAAAA
AGATACGGTGAAACTGAAAAAAGTGTTACTGGGAGCAACTAATAGCATCAGTTTTAGAGT
TAACATCAAAGCTAGTACGCTTCATCACTGATGGGCTTCCCTCCCATTAACTCAAGTATT
GCTCAAAAGAATGCAGATATGTAACTTTTGGTTTAGGATACTAAAGTAATCGATTTCTTT
ATTACTTGTTTCAAGAGCAATTACTTAATTGTGGTGCAAGATGCATTGGCTAATTTCATA
GAGATTTTACCCAAGATGCCTGATCATGTAGTAGCTAAACGCCTTGATGAACTCGTCTTT
TTGCTACAGGATAAGCTTAAAGTGGCAATGATTTAATAAGAGTTGGAACAGGAAGAAGAC
TTCAATCGAGTACTTGTTTGCAATAATAGTTGCTGGGCATTAGGTGAACTTACTCAAAAT
CACAAAGAAACAATGAAAAGATATTCCACTAGCATAATTCAAACACTTTCAGACATCCTC
AACTAAGACTTGCTGACTCAGTTATCTCTAAAGAATGAGGAAATTCTTAAACATTTCTCG
AAAACGATCTCAATTACACTCGGCAGATTAGGACTTTTAAACCCAGAAGAAGCTTCACAG
TATCTTCCCTCCATCATAAAGCCATGGTGTGTAGCTTTGAGATACATGAATGCTAGCGAT
GAGAAAGTACAAGCTTTTAAGGGACTTTGTGGAATGATCCCCTTTAATCCAATCGGCATT
GCAGAAAGCTTCCCCTACTTCTGTGAGGCTCTTGTTGAGTTTAACAATCCACCATAAGAC
TTGGAGAATATATTTTAGAATTTGATAATCACTTATAAGCACTGCTTGGGTGAACAGGAG
TGGACCACTTATATATAAAGTTTTCCTCCTCAATTAAGATAAGAACTTTCTTATAGATTT
AGACTTATTCCTGCTGGGGATAGTCACAACCAGTAGTGA


>Contig18963.0.g36(protein)
MLYQNHSQSFDVEDLYSQEKTLILSLVALLVTTDDAYEDMKLGVTNVLLKKLNIKFVDAN
LSNKEKEYLAKTIIFALSQNDDPHLRQNITQLIANLLLPLQSKKSTDVSRGSQSKSGNGS
KGDVTIDKTSEVLSEMLKFSNLDDQSADNSQILLGIDTRNESTNSNERRSREQKRSLLQL
LFQQMACEMHATDERKAEIVLDSLEQILNIAKSSNNSYLIVENIQEQDFLLEYLLESLTF
LISNRTSKNLVQLAMQVTTYLIKQASLKSSISCLLSNLLEVLFKIVPSENEEIILSGVLC
ITEIFTKEPYLVIKAYESGFDFQLFFNAVKSADPEMALAGIEFWQKFIMIDTVIYKQDFK
KQLFEQLLPMMLDQCKLKNEDYEKFMRDKRQANVLERKRQITRKTIRSKAAQTIEIISEK
FQKEVFTSLKSQLESYINSKSNWVDKEAAILVLGVISGFKTEFKQIEAQLLKLVPLLIEE
LSGTNAQVKATTCWTLSTHSFTEWLTTQENQLFFHYVDRLLLLLSDEEKSVQKSALSNFQ
QLLQTPNVKNKLAPRLNLFIDAFTKAFGNADHYTMMSLNDAIYHSCLCFGDKASDLAYQV
MPYLVQSFQITSDEQSNSIYSLIDCLIQVTSVLQGRVSQWAGELIERSHLIIITILKNKT
QLIGDHQQQNLNISFTALKDQDNEIAVIQKIIELVQNVLKRYGETEKSVTGSNQQHQFQS
QHQSQYASSLMGFPPINSSIAQKNADMQLLVQDTKVIDFFITCFKSNYLIVVQDALANFI
EILPKMPDHVVAKRLDELVFLLQDKLKVAMIQQELEQEEDFNRVLVCNNSCWALGELTQN
HKETMKRYSTSIIQTLSDILNQDLLTQLSLKNEEILKHFSKTISITLGRLGLLNPEEASQ
YLPSIIKPWCVALRYMNASDEKVQAFKGLCGMIPFNPIGIAESFPYFCEALVEFNNPPQD
LENIFQNLIITYKHCLGEQEWTTYIQSFPPQLRQELSYRFRLIPAGDSHNQQ