Identifiers and Description

Gene Model Identifier

Contig8327.0.g41

Standard Name

TRMT61A

Aliases

Contig8327_0_g41

Description

tRNA methyltransferase complex GCD14 subunit

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam08704 ) tRNA methyltransferase complex GCD14 subunit
  • ( pfam13847 ) Methyltransferase domain
  • ( pfam13659 ) Methyltransferase domain
  • ( pfam12847 ) Methyltransferase domain
  • ( pfam08242 ) Methyltransferase domain
  • ( pfam00398 ) Ribosomal RNA adenine dimethylase
  • ( pfam05175 ) Methyltransferase small domain
  • ( pfam01135 ) Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)
  • ( pfam06325 ) Ribosomal protein L11 methyltransferase (PrmA)
  • ( pfam13578 ) Methyltransferase domain
  • ( pfam02029 ) Caldesmon
  • ( pfam08241 ) Methyltransferase domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007979809.996907204735647e-62hypothetical protein
SGDYJL125C6.002077021906841e-60GCD14 SGDID:S000003661, Chr X
from 186679-185528, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig8327.0.g41(coding)
ATGGATCAATAGCCTATTGATACAACCTCTTCAGATTAATAATAAGCATTAGCCGATCAG
AATAGTGTTTAGCCCAAGAACGTGTTTTCTTATACCTCAGACAACATGATTAAAGAAGGT
GATACTGTGATAATCTGGGAGTCTGCCGATTCTATTAAGCAAATCCAAATGAAAAGAGGG
AGCACATTCTAGAATAAACATGGGGCATTCCCTCACGGCGACATTATCGATAAAGTGGAG
TATGGCACTAAAGTTTTCTCGAAGTCTATGATGGGGTGGATGCATATTCTCAGACCCAAT
TCACATATCTATACTACCAGTTTGGCACAGAGAACGTAGATATTGTATACTCCAGATATC
TCTTAGGTGCTATTTAAACTTGAGTTGTAACCTGGATATAGAGTGGCGGAGAGTGGTACT
GGAAGTGGAAGTTTATCAGTATCTATTCTTAAAACAATAGTCCCAACAGGTCACTTATTC
ACTTATGAATTTAACCAAGTTAGAGCTGAAAAAGCCAAGGAAGACTTCTAAAGACTAGGT
TTCTATCCTAATAACGTACATGTGACTCACAGAGATGTCTTAAACAATGGTTTCCTGTTG
AATGATGACTAAACTCAGGAAGTTTTGGTGGCTCCTGGTAGTATCGATGCGATCTTTTTA
GATTTACCCAGTCCAGAGAGAGCTGTACCTCACGCCTATCAAGTGTTAAGAAAAGGTGGG
AAATTGTGCAATTTCAGTCCATGCATCGAATAAGTGCAAAAAGCAGTCACTGAAATGGCC
AGATAGGGATTCTATGAAATCAGGACTTATGAAACTCTAACTAGAGAGTACACAGTTAAC
AAGTATGAATACGAATCATTGAATAAAGTTAAGAAGGATGTTTAAGAAGAGGAGGATTAG
AGCAAGTAGCAACTTAACAAGAGAACTTAAAAATAAAAAGATAAAAATATGATTGTTACA
GCTCCTAGAATTGATTAAAGAGGACATACTGGTTTTCTTACTTTCGCTATAAAGTTTTGA


>Contig8327.0.g41(protein)
MDQQPIDTTSSDQQQALADQNSVQPKNVFSYTSDNMIKEGDTVIIWESADSIKQIQMKRG
STFQNKHGAFPHGDIIDKVEYGTKVFSKSMMGWMHILRPNSHIYTTSLAQRTQILYTPDI
SQVLFKLELQPGYRVAESGTGSGSLSVSILKTIVPTGHLFTYEFNQVRAEKAKEDFQRLG
FYPNNVHVTHRDVLNNGFLLNDDQTQEVLVAPGSIDAIFLDLPSPERAVPHAYQVLRKGG
KLCNFSPCIEQVQKAVTEMARQGFYEIRTYETLTREYTVNKYEYESLNKVKKDVQEEEDQ
SKQQLNKRTQKQKDKNMIVTAPRIDQRGHTGFLTFAIKF