Identifiers and Description

Gene Model Identifier

Contig14985.0.g4

Standard Name

TRMT6

Aliases

Contig14985_0_g4

Description

Gcd10p family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam04189 ) Gcd10p family
  • ( pfam08704 ) tRNA methyltransferase complex GCD14 subunit
  • ( pfam11130 ) F pilus assembly Type-IV secretion system for plasmid transfer

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005226703.0010664139725277e-29hypothetical protein
SGDYNL062C3.0007793728221555e-22GCD10 SGDID:S000005006, Chr XI
V from 510212-508776, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14985.0.g4(coding)
ATGTTAATTAAGGAAGGTGATAATGTAGTCATGTTTGACAACTCATCAAACTATAGAATT
ATCAAAGTTAAAGCTACTGGTAAAAAGATAAAGCACTTCAAGGCGATGATAGATTTGAGT
TAATTGATAGGTAAAGAGTGGGGCAGTTTCTTTGAGGTCAAGGACAGCAAATCAGGATAG
TTGCAATAAGTAACTGATGTACATTCGCTTACAGCTGCCTTCCTGGAGGATGTTGATTTC
TCTAATGGAGCCAACCCAGCTGATGAGGAGGAAGAAAAATAAGAATAAATTAACACATCA
AGTGCAAATTAAGGCAGCAACACCATAAATATAAACCAAGTAACTGGGAGAGACAATAGA
GACTATGTAGATGATAATAAGTCACAAAAGCTCACACATGAATAAATAGAGGACTTAAAG
AAGCAGGGCATAACTGGTAATGAACTGATTAATCACTTGGTTTAAAATTCAGACACATTT
GCTAAGAGAACTAAGTTTTCATAAGAAAAGTATTTAAGGAAGAAGAAACAGAAGTATCTA
GTTACATTCTAGGTGAAGAAGCCAACAGCATTTGAACTTTGCAATGTTTATTCCTAAACA
AATCCAGTGAAGATTATGGCTTTAAGGCCAGACTCCCTTGGTTTGTTGCTGAATATGGCA
AACATTAATTATGAGAGCAGAGTACTTTTATGTGATAAGACTAGAGGACTACTTGCGGGG
TCATTAGTTGAAAGAGATGTCAGAGAAATCATGCATGTGGAATTCAGTGGTCATTAAGTG
AAGTTAACTACTGAAATTCTTATGGAATTCAACTTTGACTACTAAAGGACAAAGGTAATT
CAGTATGTGCAACATTCAACCATAAACAAAGAAGAGACAAAGAGTGACCCATTACTCTAA
TAACTTCTCTAACCAAAGACCAAGCACTTTAATTCAGTAATGATAGTTCATGATGACTAC
CATCCAACTGAGATCTACTAAAGTATTGAACACTTAGTTTAGCCTTCAGCAAGCGTAGTC
GCTTTCTCTTAGTACATTCAGCCACTCGCTGAACTAAGAGACTACTTAGTTTATCAAAAG
AAGGCAGTTAATGTGAGAATTGAAGAACTTTGGACTAGAGAGTATCAAGTATTGCCACTC
AGGACTCATCCTCATATGAGCATGCATGGCGCTAGTGGATTTGTTCTATCTGCTGTTAAA
GTAGAGTGA


>Contig14985.0.g4(protein)
MLIKEGDNVVMFDNSSNYRIIKVKATGKKIKHFKAMIDLSQLIGKEWGSFFEVKDSKSGQ
LQQVTDVHSLTAAFLEDVDFSNGANPADEEEEKQEQINTSSANQGSNTININQVTGRDNR
DYVDDNKSQKLTHEQIEDLKKQGITGNELINHLVQNSDTFAKRTKFSQEKYLRKKKQKYL
VTFQVKKPTAFELCNVYSQTNPVKIMALRPDSLGLLLNMANINYESRVLLCDKTRGLLAG
SLVERDVREIMHVEFSGHQVKLTTEILMEFNFDYQRTKVIQYVQHSTINKEETKSDPLLQ
QLLQPKTKHFNSVMIVHDDYHPTEIYQSIEHLVQPSASVVAFSQYIQPLAELRDYLVYQK
KAVNVRIEELWTREYQVLPLRTHPHMSMHGASGFVLSAVKVE