Identifiers and Description

Gene Model Identifier

Contig1364.1.g31

Standard Name

TRMT5

Aliases

Contig1364_1_g31

Description

Met-10+ like-protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam02475 ) Met-10+ like-protein
  • ( pfam05175 ) Methyltransferase small domain
  • ( pfam02005 ) N2,N2-dimethylguanosine tRNA methyltransferase
  • ( pfam13659 ) Methyltransferase domain
  • ( pfam06325 ) Ribosomal protein L11 methyltransferase (PrmA)
  • ( pfam09445 ) RNA cap guanine-N2 methyltransferase
  • ( pfam13649 ) Methyltransferase domain
  • ( pfam03602 ) Conserved hypothetical protein 95
  • ( pfam12847 ) Methyltransferase domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYHR070W9.998397555368434e-52TRM5 SGDID:S000001112, Chr VII
I from 234881-236380, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1364.1.g31(coding)
ATGACTGAGATTCTGAAAGAACTTCTTCCAGTGGATGTTGGCGAAGTACCTTCTGGCTAC
GAAACTGTAGGAGACATAGCGCACATGAATTTACTTGGAAAACAGCTCGAGCATAGATAT
TTGATTGGTTAGGTTGTCCTTGATAAAAATCCTATGTTAAGAACTGTTGTAACAAAATTA
GGTTAAATTGAGAGCACATACAGATTCTACGATTTAGAGTGTATCGCTGGGGATAGCTCA
ACCTATGAGACTATTGTCAATGAGGATAAAGTTAGATTCAAGGTTGACATATCCAAGGTA
TATTGGTGCTCTAAATTGGGAAGCGAGAGAAATAGGATGATTGATACTATTCTAAAGGAA
GGAGATGTCCTTTGCGACATGTTTTGTGGAATTGGACCACTAGCTGTAAAAGTTGCAGTT
AAAAAAAGGGTAAGAGTTGTTTGCAATGACTTAAATCCTGAATGCTTTAACTATGTAAAT
TAAAACATCAAGTTTAATAAAGTAGAGAAGCTTGTAAAACCATTCAATATGGATGCAAGA
GAATTTGTTAAAATGGTAGTTAAAAAGAGCAATGATCCAAATTAGACTGAGATCCCAGAA
TCGATGTTAAAATTTGATCACTGTTACATGAATCTTCCAGTAGATGCAGTAGAATTTTTA
GATGCTTTCATTGGTCTCTTTAATCATGCAAATTATAGAGTATGGTCTTCAAATGATACT
TAGGATCCTAAGACCTATCAATTGCCTATGATACATGTCTATGGTTTCACATTCAGAGCT
GAAAAAGAAAAAGCTTTGGACTATTTTGTTGAGAGAATAGGCAAGGCAATGGATTACCCT
GAGTTTAAAGCTGAGGATATTTTACACTTTCATAACATCAGAGATGTTTCTCCATAATCT
CATATGTATGGGATCAGTTTCAAGTTGCCATTTGAGGTTGCATTTAGAGATGTTAAATAA
AATAAGGAATAACAGTAAGACTATAATAAGGAAGCCTTATATCAAGAGTTTGAAGATAAA
AGTAGGATGAAGATGCAAAAGATTTAAGATGATCAAATCACTAAATGA


>Contig1364.1.g31(protein)
MTEILKELLPVDVGEVPSGYETVGDIAHMNLLGKQLEHRYLIGQVVLDKNPMLRTVVTKL
GQIESTYRFYDLECIAGDSSTYETIVNEDKVRFKVDISKVYWCSKLGSERNRMIDTILKE
GDVLCDMFCGIGPLAVKVAVKKRVRVVCNDLNPECFNYVNQNIKFNKVEKLVKPFNMDAR
EFVKMVVKKSNDPNQTEIPESMLKFDHCYMNLPVDAVEFLDAFIGLFNHANYRVWSSNDT
QDPKTYQLPMIHVYGFTFRAEKEKALDYFVERIGKAMDYPEFKAEDILHFHNIRDVSPQS
HMYGISFKLPFEVAFRDVKQNKEQQQDYNKEALYQEFEDKSRMKMQKIQDDQITK