Identifiers and Description

Gene Model Identifier

Contig5027.0.g20

Standard Name

TRM2

Aliases

Contig5027_0_g20

Description

tRNA (Uracil-5-)-methyltransferase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam05958 ) tRNA (Uracil-5-)-methyltransferase
  • ( pfam13847 ) Methyltransferase domain
  • ( pfam12847 ) Methyltransferase domain
  • ( pfam05175 ) Methyltransferase small domain
  • ( pfam06325 ) Ribosomal protein L11 methyltransferase (PrmA)
  • ( pfam13659 ) Methyltransferase domain
  • ( pfam02475 ) Met-10+ like-protein
  • ( pfam03602 ) Conserved hypothetical protein 95
  • ( pfam01209 ) ubiE/COQ5 methyltransferase family
  • ( pfam13649 ) Methyltransferase domain
  • ( pfam10294 ) Putative methyltransferase
  • ( pfam13489 ) Methyltransferase domain
  • ( pfam01728 ) FtsJ-like methyltransferase
  • ( pfam08241 ) Methyltransferase domain
  • ( pfam09445 ) RNA cap guanine-N2 methyltransferase
  • ( pfam01135 ) Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)
  • ( pfam01555 ) DNA methylase
  • ( pfam05401 ) Nodulation protein S (NodS)
  • ( pfam13679 ) Methyltransferase domain
  • ( pfam08242 ) Methyltransferase domain
  • ( pfam01170 ) Putative RNA methylase family UPF0020
  • ( pfam02390 ) Putative methyltransferase
  • ( pfam05724 ) Thiopurine S-methyltransferase (TPMT)
  • ( pfam14259 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004375602.9994041385173996e-93hypothetical protein
SGDYKR056W1.000116773704384e-19TRM2 SGDID:S000001764, Chr XI
from 549448-551367, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig5027.0.g20(coding)
ATGGAGAGTATAGGTAGTGCTTAAAACATTCAAGAGCAAGCTTCAAATGTGGATTAATCA
GTTCACTCTGATAATCAACCATAGAACGAAGAGGTGAAAGAGTCAAAGCAAAATGATATA
AATAAAGAGAGACAGTTCAAAAGTCAAGTAATTCCAGTGAGTTTATGCGTCACTGGATTG
CAGCCACATATGATTGAAAAAGACCTTATAAAATTCTTTATGAAGGCACTTAATAGAGAA
GATTTACCCCTACAAGGTGTCCTCAAAAAGAGAGGCAATAACTTTGCTTTCTTATCATTT
ACAGACTAAGAGCAATTGAAATCTTTCAAAGAACTTTTTATGACAGAAATAATGCCAAAC
ATGCCAAAAATGCGTCTAAAAGAATCAACCAAGAAAATCAACGCAAAAGAGTATAAACCC
GTAAAAGATAGAGAAGGCATGAGATAAGACGCTGATCGCAAGAAAGAAAGACAAATCTAG
AATATAACGCCAGAGGAAATTGCTGAAGAAATGAAAATTAGTGTGGAAGATAGAGTCACT
CCTTATCATCATTTGGATTACCCAGAGCAAATTAAGAGGAAAGAATAGTAGCTTATTGAA
GTATTAAAGGGTTTTACTTCTTAACTTGAAAGAGATATATAGAAAAATGGAGAACAAAGA
CCTTCTTGGTTTAGTATGGATAAAGACCTACCATGTGAACTCTCACATGTAATAGAATGT
GATCTTGACTATATAAATCAATATAGAAATAAAGTTGAGTTCACAATAGGGAGAAGATTT
GAGGATAATGAGATATGTGTCGGTTTTAATAAGGGAAATATGAGTAAGGGTATTATGTAC
GTAGATTACCCAGACAACATCAAATCTATTTCAGATTCTTCAGTTTAAGTTGCGAAGATA
GTTGAAAAAATCGTAAAAGATAGTGGTATAGAGCCTTATGATAGAAAGATAAATCAAGGC
TTCTGGAGAATTTTACTCTATAGAGAGTCAAAGAAAACTAACTAAGCATTAATTAGCGTT
GTTGTTTCAGAAGACTATTTAGTGACTGAAGAGCAATTAACTGCAATTGAGTAAGCTCTG
ATTGCAAATTTTGCAGAAAATACCAAGTTAGGATAGCACACTATAGTCTCACTTAGTATG
ATTTTTTCTAACGAAATATCTGGAGCTTATAAAGAAACCGACAAAGTTAAACTTTTAAGT
GGGCAGATGAACTATGAAGAGCAATTATTCGATTTCAAATTCACAGTTTCACCATTTGCA
TTCTTTCAAGTAAACACTAATGTTTTTGAAAAAATGTTGAAACTCATAGAGGATTTTACT
AAAATCAATGAGAATACTGTCGTTCTAGATATTTGCTGTGGTACAGGGGCAATAGGAATA
TGTTTGTCAGCTAAAGCCAGGAAAGTTATCGGTGTTGATATCATAGAATCAGCAATTGAA
AATGCAAAATAAAACATCTAGTTGAATAAGGATTTGATCGACCCTGCCAAATGTGAATAC
TATGCTGGAAGAGCAGAAGAAGTATTACCTAATATAGTAAAAGACTGCTAGGCACTCGGT
TTTGAAATAATAGGGATAGTTGACCCTCCAAGAAGTGGCTTACACAAAGATGTACTCAAA
TTGTTGAGAACTTGCAAGGGTTTAGATAGGCTAGTCTATGTGTCCTGCAATCCATAAACT
CAAATGAGAGACATGCAAGCATTATGCTATGAACCTACCAAGAAACGTAAGGCACCTGCT
TTCTAACCATTAAAATGCATTGGAGCTGATTTGTTTCCTCATACAAATCACGTTGAGTCA
ATAATCCTAATGGAGAGATTCTATAAATGA


>Contig5027.0.g20(protein)
MESIGSAQNIQEQASNVDQSVHSDNQPQNEEVKESKQNDINKERQFKSQVIPVSLCVTGL
QPHMIEKDLIKFFMKALNREDLPLQGVLKKRGNNFAFLSFTDQEQLKSFKELFMTEIMPN
MPKMRLKESTKKINAKEYKPVKDREGMRQDADRKKERQIQNITPEEIAEEMKISVEDRVT
PYHHLDYPEQIKRKEQQLIEVLKGFTSQLERDIQKNGEQRPSWFSMDKDLPCELSHVIEC
DLDYINQYRNKVEFTIGRRFEDNEICVGFNKGNMSKGIMYVDYPDNIKSISDSSVQVAKI
VEKIVKDSGIEPYDRKINQGFWRILLYRESKKTNQALISVVVSEDYLVTEEQLTAIEQAL
IANFAENTKLGQHTIVSLSMIFSNEISGAYKETDKVKLLSGQMNYEEQLFDFKFTVSPFA
FFQVNTNVFEKMLKLIEDFTKINENTVVLDICCGTGAIGICLSAKARKVIGVDIIESAIE
NAKQNIQLNKDLIDPAKCEYYAGRAEEVLPNIVKDCQALGFEIIGIVDPPRSGLHKDVLK
LLRTCKGLDRLVYVSCNPQTQMRDMQALCYEPTKKRKAPAFQPLKCIGADLFPHTNHVES
IILMERFYK