Identifiers and Description

Gene Model Identifier

Contig19895.0.g63

Standard Name

TRM1a

Aliases

Contig19895_0_g63

Description

N2,N2-dimethylguanosine tRNA methyltransferase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam02005 ) N2,N2-dimethylguanosine tRNA methyltransferase
  • ( pfam02475 ) Met-10+ like-protein
  • ( pfam13659 ) Methyltransferase domain
  • ( pfam03602 ) Conserved hypothetical protein 95
  • ( pfam10294 ) Putative methyltransferase
  • ( pfam07193 ) Protein of unknown function (DUF1408)
  • ( pfam01596 ) O-methyltransferase
  • ( pfam12847 ) Methyltransferase domain
  • ( pfam06325 ) Ribosomal protein L11 methyltransferase (PrmA)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003003202.0001925730668994e-91N2,N2-dimethylguanosine tRNA m
ethyltransferas...
SGDYDR120C7.996885557285438e-77TRM1 SGDID:S000002527, Chr IV
from 693261-691549, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19895.0.g63(coding)
ATGGAATCTAGAGCAAAAGCTTAAAAGTCTCAATCAGACTTGAAGTAAAATGTACCTGCG
GGGTATTAAGTTCTTACAGAGGGCCAAGCTTAAATATTGTACAAAGAGGAAAAGTTGCAA
GCAGATGAAAATAATATGATTAAAACTGGAAAGGGCAAGAGATAGGCTAATGATTAAAAT
GATGTGAGAGGCACAGTATTCTACAATCCAGTTTAAGAATTTAACAGAGATTTTAGTATA
CTTGCAATTAGAGAGTTTGCTAAATTGAAGAAAGAAGAACGCGAAAAGAAAGGAAGAGAC
TTTTAGGGTATATCCATTCTTGAGGCATTAGCAGCCACTGGCCTGAGATCAGTTAGATAT
ATGAAGGAAATTCAGCCAGTAAAATTGCTAGCAAATGACATTGATCCTACTGCAACAGAG
CTAATGAAGAAAAATTTCGATTTCAATGGCATTGATGAGAAAATCTATTAAATTGCAACT
GAGGATGCTATAGATGTCATGAACCTTTAGAGGAGACAAAAGACTTTCTTTGATGTTGTT
GATCTTGATCCTTATGGAACTGCAGTGCCTTTCTTGGAGTCTGCTCTAAATTCCCTAGCA
AATGGAGGTTTATTAGCTGTTACTTTCACAGATATGGCTGTCTTATGTGCAAGGAATCCC
TAAGTCACTTTCTACAAGTATGGAGGCTCCCCTCATAACAAACGATATTGTCATGAAATG
GCTTTAAGACTAGTTTTGCATATGATCAGTGAAATGGCAAGTAGATAGCAAAGATATATT
GAGCCACTTATTTCCTTGACAGTCGATTTCTACGTGAGATTATTTATCAGAGTTCACGAT
GGAGCCTAAAAGTGTCACTCTGCCATTACAAAGTATAGTCATGTGTTCTAATGCTTAGAT
TGTGAAAGTTTTTGGCAATTGCCATTCGGTGTTCATATGGAATAAGAAATAAAGAGAGAT
GAGAAGGGACATGTCATCGATAAAAAGACTCATAAAAAGGGAGGATCATAGTATGAAGAA
CACAGAAAAAAAGACAAAGAGGAAGAAATTAAAGGAGAATCAAAGATAATTGATAAGTAT
CAGATTTCAAGATTGACTGTACCAAACAGATGCACAGTATGTGAAGGACCAATTGCAATG
GGTGGTCCAATTTGGAATTAGAAAATTCATGATGTTAATTTTGCTTAAAGATTGCTCGAG
GTCTCTAGAAAGAATTCGGACAAGAAAATGCCTGAAGAATAAAAAGAAGTTAAACTTGGA
ACATCAAAGAGAATAGAAGCAATTCTTTCAGCTATTATAGATGAAGATGTTTGTGGAGAT
TAGCCATTAAGTTTCGATTTTTCATAAATTGCTAGCTCACTTAAGTCTTAAAACCCTAAG
AAAAATGAACTTTTCACTGCATTTAAGAGTCTAGGATATAACTTGACTTAAACTTACTAC
GAGCCAAAATTGTACAAAACTAATGCCCCTCCTGAAGTAATATACGACATCTTTAAGGCA
TTTAAATCACAAGATGTTAAGAATGATCAAGAAAAGTTATTCTTAAACATCCATCCAAGC
AGCTTTGCTCACAGAATTTTATCTGCCCCAATCAAACATCAACCAAACTTCGTTGAAGAA
GTAGTGGAAGGCTAAGAACCAAAAGATAAGAAAAAGGTTGGAAAAAAGAGATATCTCCCA
AATCCTCAGCCTAACTGGGGCCCCAAAGCTAGAGCGACTGGCAATAATAAATGA


>Contig19895.0.g63(protein)
MESRAKAQKSQSDLKQNVPAGYQVLTEGQAQILYKEEKLQADENNMIKTGKGKRQANDQN
DVRGTVFYNPVQEFNRDFSILAIREFAKLKKEEREKKGRDFQGISILEALAATGLRSVRY
MKEIQPVKLLANDIDPTATELMKKNFDFNGIDEKIYQIATEDAIDVMNLQRRQKTFFDVV
DLDPYGTAVPFLESALNSLANGGLLAVTFTDMAVLCARNPQVTFYKYGGSPHNKRYCHEM
ALRLVLHMISEMASRQQRYIEPLISLTVDFYVRLFIRVHDGAQKCHSAITKYSHVFQCLD
CESFWQLPFGVHMEQEIKRDEKGHVIDKKTHKKGGSQYEEHRKKDKEEEIKGESKIIDKY
QISRLTVPNRCTVCEGPIAMGGPIWNQKIHDVNFAQRLLEVSRKNSDKKMPEEQKEVKLG
TSKRIEAILSAIIDEDVCGDQPLSFDFSQIASSLKSQNPKKNELFTAFKSLGYNLTQTYY
EPKLYKTNAPPEVIYDIFKAFKSQDVKNDQEKLFLNIHPSSFAHRILSAPIKHQPNFVEE
VVEGQEPKDKKKVGKKRYLPNPQPNWGPKARATGNNK