Identifiers and Description

Gene Model Identifier

Contig8741.0.0.g9

Standard Name

TRM11b

Aliases

Contig8741_0_0_g9

Description

Putative RNA methylase family UPF0020

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000519702.000214949834694e-50conserved hypothetical protein
SGDYOL124C6.998168281769004e-37TRM11 SGDID:S000005484, Chr XV
from 86757-85456, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig8741.0.0.g9(coding)
ATGCATGGTGTCAGAAGAGAGCAGTTGTTTGTTTAACCTAAGGAATCGTTGAGAGACATA
TAAAAGAACCCATTAGTGTATGTGAACTTACCAAATGAAGATATCGCGCACAAAATACTT
CGCAGATCTATACTAATTAAGGAAATTATCGATGTTTACTCTAGTGGAAAGACTTATGAA
GAGCTGCTAGAAAACGTAGATAAGGAAAAATTATATCCAATATTAGAATTAGACAAGAGC
TTTAAATTTAGCATTGAAGGCATTGGTAGAAAAATTAGTCATTAAGAGTAGATTAAAATT
ATTGAGTCATTTAGAATATTTCCATTCAATAAGAGGATTGATATTAAGAACGGAGAAATT
ACCTATAGAGTCGTAGAGAATAACGAAGATCACATGATTTACTTCGGCAGGGAAATAGCA
TCGAATAGAATTGAGGAAGACACTTTTCATGTACGATATGACCTAAAAAAGAGACCTTAT
TTAGGTCCTACTTCAACAGATCACGAACTGGCTTTCCTTATGGCAAATCAGGGCCAAGTG
AAAGAATTTGACTTCGTTTATGATCCCTTCGTTGGAACAGGCTCAATAGCTGTATCTTGC
AGTCATTTCGGTTGCATTCAATATGGGAGTGATTTAGATATCAGAGTATTGAAAGGGTAT
GGAGTAGGCAGAAAATCAAAGAACATTGATAAGATTAAGGATGCAGACAAAATCAAGCGT
TTTGATGTGTTCACTAACTTCGATTACTATGGAATTCCAAGACCTGAAATCATGGCTTCT
GATTTTTCAAAACCCCCTTTTCACTGTTTAGGTGAGCGCGGGCCCATACTAGATGCTATT
ATTTGTGATCCTCCATATGGCGTGAGAGCAAGAACTCACAAAATCGGTATCAGTGATAAC
AAGTAAAAACAACTCAGAAGAGTAGAAGAAAGAAGAGGAGCCTCATTATAGTATGAAAGA
GCAATATGA


>Contig8741.0.0.g9(protein)
MHGVRREQLFVQPKESLRDIQKNPLVYVNLPNEDIAHKILRRSILIKEIIDVYSSGKTYE
ELLENVDKEKLYPILELDKSFKFSIEGIGRKISHQEQIKIIESFRIFPFNKRIDIKNGEI
TYRVVENNEDHMIYFGREIASNRIEEDTFHVRYDLKKRPYLGPTSTDHELAFLMANQGQV
KEFDFVYDPFVGTGSIAVSCSHFGCIQYGSDLDIRVLKGYGVGRKSKNIDKIKDADKIKR
FDVFTNFDYYGIPRPEIMASDFSKPPFHCLGERGPILDAIICDPPYGVRARTHKIGISDN
KQKQLRRVEERRGASLQYERAI