Identifiers and Description

Gene Model Identifier

Contig16082.0.0.g99

Standard Name

TRM11a

Aliases

Contig16082_0_0_g99

Description

Putative RNA methylase family UPF0020

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000519709.001802505664736e-52conserved hypothetical protein
SGDYOL124C2.0005131442217614e-40TRM11 SGDID:S000005484, Chr XV
from 86757-85456, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16082.0.0.g99(coding)
ATGGAGTCTAAACTAGTAGCTTCCACTTCTCGCTATCTCGTGCACTTTATCAAGAAATTC
AAGTATCTGGATTTCTGCTTAAACGAATTAGAAACGCTAGCTGACATGCATGGTGTCAGA
AGAGAGCAGTTGTTTGTTTAACCTAAGGAATCGTTGAGAGACATATAAAAGAACCCATTA
GTGTATGTAAACTTACCAAATGAAGATATCGCGCACAAAATACTTCGCAGATCTATACTA
ATTAAGGAAATTATCGATGTTTACTCCAGCGGAAAGACTTATGAAGAGCTGCTAGAAAAC
GTAGATAAGGAAAAATTATATCCAATATTAGAATAAGACAAGACCTTTAAATTTAACATT
GAAGGAATTGGTAGAAAAATTAGTCATTAAGAGTAGATTAAAATTATTGAGTCATTTAGA
ATATTTCCATTCAATAAGAGGATTGATATTAAGAACGGAGAAATTACCTATAGAGTCGTA
GAGAATAACGAAGATCACATGATTTACTTCGGCAGGGAAATAGCATCGAATAGAATTGAG
GAAGACACTTTTCATGTACGATATGACCTAAAAAAGAGACCTTATTTAGGTCCTACTTCA
ACAGATCACGAACTGGCTTTCCTTATGGCAAATCAGGGCCAAGTGAAAGAATTTGACTTC
GTTTATGATCCCTTCGTTGGAACAGGCTCAATAGCTGTATCTTGCAGTCATTTCGGTTGC
ATTCAATATGGGAGTGATTTAGATATCAGAGTATTGAAAGGGTATGGAGTAGGCAGAAAA
TCAAAGAACATTGATAAGATTAAGGATGCAGACAAAATCAAGCGTTTTGATGTGTTCACT
AACTTCGATTACTATGGAATTCCAAGACCTGAAATCATGGCTTCTGATTTTTCAAAACCC
CCTTTTCACTGTTTAGGTGAGCGCGGGCCCATACTAGATGCTATTATTTGTGATCCTCCA
TATGGCGTGAGAGCAAGAACTCACAAAATCGGTATCAGTGATAACAAGTAAAAACAACTC
AGAAGAGTAGAAGAAAGAAGAGGAGCCTCATTATAGTATGAAAGAGCAATATGA


>Contig16082.0.0.g99(protein)
MESKLVASTSRYLVHFIKKFKYLDFCLNELETLADMHGVRREQLFVQPKESLRDIQKNPL
VYVNLPNEDIAHKILRRSILIKEIIDVYSSGKTYEELLENVDKEKLYPILEQDKTFKFNI
EGIGRKISHQEQIKIIESFRIFPFNKRIDIKNGEITYRVVENNEDHMIYFGREIASNRIE
EDTFHVRYDLKKRPYLGPTSTDHELAFLMANQGQVKEFDFVYDPFVGTGSIAVSCSHFGC
IQYGSDLDIRVLKGYGVGRKSKNIDKIKDADKIKRFDVFTNFDYYGIPRPEIMASDFSKP
PFHCLGERGPILDAIICDPPYGVRARTHKIGISDNKQKQLRRVEERRGASLQYERAI