Identifiers and Description

Gene Model Identifier

Contig19427.0.g8

Standard Name

TRIT1b

Aliases

Contig19427_0_g8

Description

IPP transferase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYOR274W2.00017271388466e-38MOD5 SGDID:S000005800, Chr XV
from 837674-838960, Genom...
T. thermophilaTTHERM_002556001.0000422327488734e-24tRNA delta(2)-isopentenylpyrop
hosphate transf...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19427.0.g8(coding)
ATGGAATCTCTAAGTAATCAAAAAGAAGAAAGCACTAATAATACCCTAGATTTATCAATT
TAATTGGAAAATCTGAATTTAAATAATATTTCAGAAAATTTAAGGAAGCAATTAGTAATA
TTTATATTGGGGACTACTGGTGTTGGTAAATCAAAACTTTCATTGGATTTGGCTTTAAAA
CTGGGTGGAGAGATTGTCAATGCAGATTCTATGCAAATCTATGATGGAAACGATGGAATA
ATGACAGCTAAGCCAACTCAAGAAGAACTCTAAAAAGTGCCGCACCATTTATATGGTGTA
GTGAACTGGCTCACATATGATTTCAATGTGAATAAATACAGAGAATTGGCATTAGAAGCC
ATAAGAGATATTCAAAGTAGAGGGAAAGTGCCAATTATAGTAGGAGGAACTAATTACTAT
ATAGAAAGCTTAGTTTATGAGCAATCTTAAATAATAGAAGAGTTTAAGTATGATAAAGAT
TAGTTTGAACAAACATTTGAGCATGAGAAATCAATCAGAGATGAAAAATTCCACGAAATT
CTAGAAGACCTGAAAGTTTTAATTCCTTTAGATAAAAAACAGGCAATTGAGGATAAATAT
GATAGCGATTTATTGCATGAACTTTTGACTTTGGTTGATAAGAAATTATCAGATTTACTA
CACAGTAAAGACAAGCAGAGCGATATTTAAATGCAATCAAAAGGGAGACAGCTAAGATTT
TTACCAATATTCATTCAAATGTCTGCTGATAAAGACATTTTAGAATCACGAATAGTCAAA
CGAATAAATTAGATGATTGATGAAATGAATGGTATTGAAGAAATTTACACATTATTTTCT
ACATTTGAACAGTGTCAAGGTATTTCAGAAGAAATGGATCCGAGCTATTTTGAGAAAGGT
ATATTTTAGTCTATCGGGTATAAAGAATTCTATCCACTCTACAGATATCTACTATACAGA
TATGCAGAAGATGGTTTATTGTACAATGAAATACTGAAAAACCCTTCAAAATAAGATAGA
GAAGAAATATAGAAAGGAAAAGACTAGTTGAAAGTTAAAACAGTCAACTACGCTCAATAT
CAACTCAAATGGTTGAATAAAAGAATAAATCAAGATTTTGGCAATAAAAATGATTCAAAT
GATAATCTATTGCTTGTAATTAACTTGAATGATCCCAAATAATATGAAGAAATAGCTTTA
AACAAAGCATTAGAGTTTATAGATATATAGGTGAAGAGATTTTCTTAATTTTCTGAGGAA
TTTGTTCAAGAATTCAAGCAAAGTTATTGCAATGAATCCAGCATGAACAAAAAAGAGAGG
CTGCTTAATTGGAAAAAAGTTTACTGTGAGAAATGTAATTAGGAATTAAATGGGTAGAAG
CAATGGCAGGAACATATTTAAACTAGGAAACACAAAAATCGAAATAAAGATAAAAAGCTA
GATAGTAATAATGAAAAACAAAGCTAAAAAAAGAAACCTAAAAATAATCAAGAAGAAATT
ATTTTTTAGGGATTTGATGATGAAATAATAGAATGA


>Contig19427.0.g8(protein)
MESLSNQKEESTNNTLDLSIQLENLNLNNISENLRKQLVIFILGTTGVGKSKLSLDLALK
LGGEIVNADSMQIYDGNDGIMTAKPTQEELQKVPHHLYGVVNWLTYDFNVNKYRELALEA
IRDIQSRGKVPIIVGGTNYYIESLVYEQSQIIEEFKYDKDQFEQTFEHEKSIRDEKFHEI
LEDLKVLIPLDKKQAIEDKYDSDLLHELLTLVDKKLSDLLHSKDKQSDIQMQSKGRQLRF
LPIFIQMSADKDILESRIVKRINQMIDEMNGIEEIYTLFSTFEQCQGISEEMDPSYFEKG
IFQSIGYKEFYPLYRYLLYRYAEDGLLYNEILKNPSKQDREEIQKGKDQLKVKTVNYAQY
QLKWLNKRINQDFGNKNDSNDNLLLVINLNDPKQYEEIALNKALEFIDIQVKRFSQFSEE
FVQEFKQSYCNESSMNKKERLLNWKKVYCEKCNQELNGQKQWQEHIQTRKHKNRNKDKKL
DSNNEKQSQKKKPKNNQEEIIFQGFDDEIIE