Identifiers and Description

Gene Model Identifier

Contig17117.0.g17

Standard Name

TRIT1a

Aliases

Contig17117_0_g17

Description

IPP transferase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYOR274W2.000620012690291e-23MOD5 SGDID:S000005800, Chr XV
from 837674-838960, Genom...
T. thermophilaTTHERM_002556000.0000029996948234116693tRNA delta(2)-isopentenylpyrop
hosphate transf...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17117.0.g17(coding)
ATGGATAAACTACGCAAAATTATCGTCATTAGTGGAATGACAGGAGTAGGAAAAACAAAC
ATAGCTAAGATACTTTCTTAACATATTAATGGAGAGCTTGTTTGTGTTGATTCTATTTAA
ATATACAAAGGACTCGAAATCTTATCAAATAAGCCTTCTAGCTCAGCAAATCAATCAGGT
TAACATGCTTTAATGAGTGATTAACAAATCCAGGGATCTGTAAATTTATCTCAAGCACCT
CACCATCTTGTTGGAAAGTACGATCCTATGAATCCAATTACCGCCTCGTAATACGCAATT
CAGGCACGTAAAATTATCAAAGACATATTATCAAGAAACAAAACACCTATACTCGAAGGA
GGCTCACCCTTCTATATCTAACAAATATTCAATCCAAACTTAACAAACTTCCAAGATCCC
ATGTTTCACAAAGCAAGAGAAGTGGCAAGAAATATCATTCAAATGGATGGAAATGATTTT
AAAAAGACCCTTGAAAGAGCAAAAGTACTGTTTTAAGCTGTCAAAATGCCTTAAGAAGAA
GTCTAAAAGATAGGTCTAAACGACTTTTATAGACTAGAAACTAAAATGGCATATTCTCTA
TATATGCAGGCTAAAGGTGAGACTTATAATAAAAATGTTGAAAGAAGTACATTTGATGAA
GAAAATCAGTTTTTCACAAATATCAATAAGAGATGTTTCTACCTCTTTGGAAACAAAAAG
TCAATCAATTAAGTTTTGGACTTGAGAGTTGAAGACATGATAATGAATGATGCCTTTTTC
CCTTAATTGGTCGACTTTTCCAAACAATGTGTAAATTAAAAAGACCCAGAATTGCATAAA
ATTAATCCATTATTTCGATCAATTGGGTTTTTAGAGTCCATACGCTATCTTTAATCTTTT
CACTAACTTGAGGGAGGCGTAAACGGAGAAAATAGCATGATTTTTATGGATTACTTGAAA
AGAAAAAGTATTAATACTGCATACTAGCATATTGCTAAATCCTATCTTGACGACTACAAA
GCCAAGAATAGACAATTTGCCCGAAAATAGAATAAATGGTTCAGAAAAGAATAAGACTAC
CTGTGGATGGACGTTATGATGGAGGGTAAAATTCATAATGTAATAAATAAGATGATAACT
TACTTGAGAAAAGACGACATCCGTAAAGATCTAGAGTCTGATGAGCAAGAAAAAATGAAA
AATGTGAACACTGAAGACGAAACCCATAAGGAGCTTAAGTTCTATAAATCAGAGAGCAGA
ATCTTGCAAAGTGATGAACTTTACTATAAATTCATGATGAATAGCTTAAGAAACGCAAAC
ACTCACAAGGGTGTTATAATGAACAAACTTTTCGTAGATGCTTGTTCAGACCCCAACATG
GTTTACCTTCCCAAGAAATATCAAAGCGTGTCCTCTAAAATCATTTAAAATAACAATGAG
ATCTTAAAGCACGTCTAATCGGGGATTAACTTTGATCAAAGCAAAATAAACATTATCTCA
AGCACAAAAGAAAAAGAAGAAAAAAGATAATAGGAGTAGGGAGAGAATTTCAACAAAAAT
AGAAAAAGTGTTAAGTAAATCTTTAAAAAATAAAGCAATCAAGATACTTACTTAAATGAG
AGTACTAATTCAAATAATTAAGACAAGTCAAGTGAAAATTAGAAAAAGAATGGGTATTAG
AAGAAGAGAAATGATTAATTAAGCTAACTGTGA


>Contig17117.0.g17(protein)
MDKLRKIIVISGMTGVGKTNIAKILSQHINGELVCVDSIQIYKGLEILSNKPSSSANQSG
QHALMSDQQIQGSVNLSQAPHHLVGKYDPMNPITASQYAIQARKIIKDILSRNKTPILEG
GSPFYIQQIFNPNLTNFQDPMFHKAREVARNIIQMDGNDFKKTLERAKVLFQAVKMPQEE
VQKIGLNDFYRLETKMAYSLYMQAKGETYNKNVERSTFDEENQFFTNINKRCFYLFGNKK
SINQVLDLRVEDMIMNDAFFPQLVDFSKQCVNQKDPELHKINPLFRSIGFLESIRYLQSF
HQLEGGVNGENSMIFMDYLKRKSINTAYQHIAKSYLDDYKAKNRQFARKQNKWFRKEQDY
LWMDVMMEGKIHNVINKMITYLRKDDIRKDLESDEQEKMKNVNTEDETHKELKFYKSESR
ILQSDELYYKFMMNSLRNANTHKGVIMNKLFVDACSDPNMVYLPKKYQSVSSKIIQNNNE
ILKHVQSGINFDQSKINIISSTKEKEEKRQQEQGENFNKNRKSVKQIFKKQSNQDTYLNE
STNSNNQDKSSENQKKNGYQKKRNDQLSQL