Identifiers and Description

Gene Model Identifier

Contig16170.0.g48

Standard Name

TRA2c

Aliases

Contig16170_0_g48

Description

RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00076 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam14259 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam13893 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYIR005W0.00000030014504373857585IST3 SGDID:S000001444, Chr IX
from 364889-365335, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16170.0.g48(coding)
ATGGATGCTGCTGTTGGTATATCAGAAACTTCTAACTTTTAAGCTTAATAGTAAATTCCT
AACGAAGACTTGAACTTAAAACCTACTTTTGACTCTAATAACTAAAGCTATTCTAATTCT
GATGCTGCAAACTTACTTAATGTTTGTTACGACGATTATGATGAATACCAGGAATAAAGT
TTGGCTTCTAAACAGACAGCTTTAAATGACTAAGAGATTCTTGACTCTGTGGAGACTTTG
CAGACACTAAACTAATAAGATTTGAAGGAGAGATGTGATTAAAACTAAATCGAACTTTAA
GACGATGCTAAGACAGCTGTATCTGCAAATCACGGGGGGAGCTAAGCAACTGAAGATAAA
GATAGTACTCTAAAGCCAAACAAAGATGCAAGTATCGCTTAAGATCGATCGATACAGATA
CAAAAAGAGTGTTTGGAAGAAGGAGGCAACTCTTAAAATCCAAGAATCATTAACATAAAA
GATGATAAAATGAGGGGTTTTAGGTCAAACTCTCAAAATGAAAATGGACAAAATTCTCAA
CTTAGCAAAGACATACACTCAAGAATCTTACTGCTTAATAAGCCAGAAAACAGACAAGAA
AGAAGTAATGAGAATATCTCAAACAGAGTAGTTACTCTTAATAGTAGATTAGAATCAGAA
AACTTGAATAATTATCCATAGGAGTATCGAAGACACAACTACTAAAATCATGGTTACAAT
CAGAATCAAAACTATAACAGAAACTACTAGCAGAGAAGAAGAGTAGAAGTAGAGATAACA
CTCAAAGATATTAATAAGACTATCATTAAAGAGGAAGATAGAACTAAGGAAGCAATTAAA
ATAGCCATTATTAATAGCAACGACCCAATAATAATGGCAGCAATCATTAATCTAACTAGT
TTTAGCAAAGGAAATGAGGACTTACCCATTGATAGATCTGAAAAATATAACCAAGAAAAT
CCAGGGAATAATGTGTACATAGCAGGGATACCAAGATGGGTAAATGAATCAGATTTGCTG
AAAACCTTTGAAAAATATGGAAAGATTTTAGAAGTGAAAGTTATCAGAGATCACATAACA
AAGAATTCGAAGGGGTTTGCCTACGTTCTATACGAAAGAAGCAGTGATGCACAGAGAGCC
ATCGAAGGTTTAGACGGCGTGAGAGTTTACAATGAATGGATGCTTAAAGTAGAGTTGGCT
AAGAGAGCTCTCCCGTATGAACCTCGTCACAATATATAGCTGTCAAATAGCATAATTAGT
GGTCAAGATTATGGTTCGGAGAATGATCGAAAGCTCTAAGAGATTAACATAAGAAAACAA
GATTTCTTGCTTGAAAGAGGCGTCGAAATTTAAAGAGAGGAGCAATTCATTGAGAGAGAA
CGAAAGAATTTTCATAAATATTAAGAAAAAGAAAGAAACTTAAACGAACAAAGAAATTAA
GATAATGAGTCAAATAAAGCTAGAAAAAGCTCATAAAATCATGAGACTAAGGATAATCGA
GACTCACATGAAAGATACTCTCGATCAAATTAGGATAACAAAATTAGAGATACTAAAATT
GAAAGAAGCCATACTAAAGAAATAATTTCAAAGGAATCTCATGAAAATTTGAAATAGAAT
GAATAAGCGAGCTCTCACAAAGTTGAAAAAGATAGAAGTAGAAGTAAAAAAAGCTTAGAA
AAGAAAAGAAGATCTCACAGCAAAGAAAAGTAGATTCTTTCTAGAGAAAGAAAGCATATA
AAAAGCTCAAGTAGAAAGAAAAATGAAAAGATCAGGAATGATGAAGATCAAAGAAGAGAG
CAGCGATCAAGAGATCATAGTGATATGAGAATAGATGAAAAAAGCAGAGATCGTCATCAA
AATAGGAGAAGTAGATCAAGAGACAATCATTAAAACAGTTATCAAAATATGCGAGACAGA
TATCCCAACAGACCAAACGGGTATTACAACAACAATAATAGACAAAATAATCACTAGCAT
TACAACAACAATCATTAGCAAAATGATTACCAAAACAACTAAAGAAATAATTACCATAAC
AACAATAGTCAAGCTTAGAGAGGAGGTCACTACGATAATCAAAGAAACGGGTATTAAAAC
TATGGGAGAGATCATCAAAATCAACAAAGATACCAATAGCAGCAGCAATACAGAGATTAT
AAAAGATGA


>Contig16170.0.g48(protein)
MDAAVGISETSNFQAQQQIPNEDLNLKPTFDSNNQSYSNSDAANLLNVCYDDYDEYQEQS
LASKQTALNDQEILDSVETLQTLNQQDLKERCDQNQIELQDDAKTAVSANHGGSQATEDK
DSTLKPNKDASIAQDRSIQIQKECLEEGGNSQNPRIINIKDDKMRGFRSNSQNENGQNSQ
LSKDIHSRILLLNKPENRQERSNENISNRVVTLNSRLESENLNNYPQEYRRHNYQNHGYN
QNQNYNRNYQQRRRVEVEITLKDINKTIIKEEDRTKEAIKIAIINSNDPIIMAAIINLTS
FSKGNEDLPIDRSEKYNQENPGNNVYIAGIPRWVNESDLLKTFEKYGKILEVKVIRDHIT
KNSKGFAYVLYERSSDAQRAIEGLDGVRVYNEWMLKVELAKRALPYEPRHNIQLSNSIIS
GQDYGSENDRKLQEINIRKQDFLLERGVEIQREEQFIERERKNFHKYQEKERNLNEQRNQ
DNESNKARKSSQNHETKDNRDSHERYSRSNQDNKIRDTKIERSHTKEIISKESHENLKQN
EQASSHKVEKDRSRSKKSLEKKRRSHSKEKQILSRERKHIKSSSRKKNEKIRNDEDQRRE
QRSRDHSDMRIDEKSRDRHQNRRSRSRDNHQNSYQNMRDRYPNRPNGYYNNNNRQNNHQH
YNNNHQQNDYQNNQRNNYHNNNSQAQRGGHYDNQRNGYQNYGRDHQNQQRYQQQQQYRDY
KR