Identifiers and Description

Gene Model Identifier

Contig14533.0.g16

Standard Name

TPR1

Aliases

Contig14533_0_g16

Description

Tetratricopeptide repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001070400.000000000029994712494008525TPR Domain containing protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14533.0.g16(coding)
ATGGATCTCTCATTCAAACTCTAATCAGCTTAAAGCTTGAAATATCAAGATTAACTAACC
CAATTAATCAGCTTAACCCGAGCCTCAAAGCTCTCAGCAGCTCAAGCACTCGCTCAAGAC
CTAATAACACTTGCAGAATAGAATACCGACTTGAATCTAAAACATTACTTCCAACTTAAA
TTGGCCAAGGTTTACTTCATTCAAGGGGAATTCTTGAAAGCAATTAAGGAAGTAGAACAA
GTCGTTGAAAAGATAGAGGAGCTAAATTAGAGTCAAATTTAAGTCATAAATGGAGACGAG
CAAGATTTGAAAAAGGAAAAGGATGAGGATTCCAAAGTTGATGTCTAGAGTGATATATAA
GACTAGGTTGAAGATAAAAAAGTAGAAGAAAAGGATGAGAAAGTTTCATAAAGTAAGGAT
GAATTAGTAGTAGAAAGCACTTCAAATATATAAGAGCAGGAATAAAAGTACATGTATCTA
AAAGCGAAGTGGTATCAAGCTTTCATTCATTCAAAGCTGAAAGATTTTGAAAAGGCTGAG
GAATTCGCAAAGCATATAAGCGATTAGATCAGATGCCTTAAAACTCCAGAAAATTATTGG
AAATTTGAATTAAAGGCACTCTATCTCAGATCTAGATAAATTGCTGGATGCATGGAATTC
AGAGCTGCTATATCTATAATCGATAAAGATGCTAAAGTTTTATTAGAAAAATTGAGTGAA
CATTACTATCCTAAAGATCACACTGAGGTCAAAGTAGAAGAAGGAAAAGAGGAAGAGATT
TAAGATTCATAATAGATTAAAAAGGTGTATTAGGATAGATATCATCATGAATTTAGAAGA
CAGACAGTTTTGTACTTGAAGAAATTTGCATATTATGATCAAGCAGCTTCATAAGTTATA
CAATTAATAAAAGATCAGGCTGAATTGTACAAGATAGAGCTTATCAAATCAGAAGATGAA
AATCAACTTCCCCATATTGATTTATCTCAATTATCAGAACAAGACTAATAAACTAAATCT
ACTTAATTACATACTATCGCTAAATCATTGTTCATACTAAGTAAAATTTATGCTTTCTAA
ATAAAAGTTAAGGAAGTTTTCGAAATTTCAGATAACCTTGAGGAATTTTACAAAACTCTA
TATAAAACTGAAAATCATATAGAAGTATTTAAGATTTGTAGAGTAAAAAAGGATTCGATT
CTTAAAAGTCACTCAGTCAGGACTCCTCACCGTCTTGATCAAGCTAAGGATCTCCTAGAT
AGATGCATCAGCATATTGAAAGTTGTTTTATAATGCGATGAGCAAACTAAAACATACTAT
GTTGCCACATGCTGTAGAGACCTTGGCGAGATTTATTTGGACAAGAAACAAAATGACGAA
GCTGAAAAGTATATACTTCAATCACAAAGAATCATAGGTGAGATCTTTTCAGATAATCAT
CCAATCATAATTGAATTTAATGCAAACCTAATTGAACTATATGCTATCAAAGAGTCCGAA
GCAGAGAGAATAAAATGTTCATAAATTGCAGAAAAAAATCTTGAAATCTCTAAGTAATAT
TATGGGTTTAGAAGTATCTACAGTTTAAAGCAAGAATTAGGATATTGCTCAAATTTAATC
AATGTTCTTAAATTCTAGGAATCATAATAGCATGTTGCAGAGATGAGACAAATCGTCACT
AAATTCCATAATGACTAGAGTGATTTAATGAATCAGTACCTGTTCTTAGCTCAAATTTTA
GCTGGTATGACTTTAATGAGCACTGAAGTAGCCACTTCAGCAGAGAAAATTCTAAATTAT
GTTTACCAAAAGTAAATTGAATACTGTGAAAATGATTAGGAACATCCTTTCCTAGAATAA
ACTTTAGTTAATATTGGTTTATTCTATAGATAATGCCAAAGATATCAAGCTTCACTTTAT
TACTGGAATAAACTAAAAGCAATTTAAAGCAAGATTTTCCATCATGATAGAGAGATTTTA
GTCTATACCTTAAAAAATATCGGCTTGTGTTACAGCTAGTTAGATCAATTTGATAAAGCC
GAGGAAACATTTTTAGAAGCAGTTACAATCATTGAAGGTTTATCGTCAAACCCCGCAACC
ATGGGAAGTTAAGAAACATAAAAATAGGATTTAGAGCAGCTATCATCTCTCTATTTTAGT
GTTTATTAAGCTTCAATCACTTTAGGTCACAAAGAAAGATCCCTCGAGTATAATTTGAAG
GCGTTAGAAGTCAACAAAAAACTCTATGGTGAGAATAGCATTAATGTTAGCAATAATCAT
TACATTCATGCTCAGCTACTTTTGAAACTTGGAAAACCTGTAGAGGCCATTGAATGGTAA
AATAAGGCATTAGCCACACTTGAGGGACTCGAATAAAGTTTGGCAAATAATTAAGAAGAA
GCTGAGAAGAGCAAAACTAAGCCAGCTGACATTTTTATCATAAGATTGAAGTACTTCTAT
CAACTGGTTAATATGTACTTCATAGCAAATGATTTACAAAACAGCATAGCTCAAATAAAC
AAAGCCTTAGACTATGTTAAGAACAACGATAATCTCACTTATAGCAATTTAGAAGACGTT
TTTAGAATCAGATAGGAGTTAAGAGCAATTGAGAGAAAAGCCTCAGCCAAACTTTAAAAT
ACAACAGCTCTCGATATCAAGCAAGCAGAGTAGAAGCCCACTGAAACTGTTGTAGTTTAA
TAATTGAAAATGTCAAGCATGCTGGGAGTATTTGGATTATTCACATCTTCCTCGTTTCTG
GCTTCATATTTACTTATGAAAAATAAGCAGTGA


>Contig14533.0.g16(protein)
MDLSFKLQSAQSLKYQDQLTQLISLTRASKLSAAQALAQDLITLAEQNTDLNLKHYFQLK
LAKVYFIQGEFLKAIKEVEQVVEKIEELNQSQIQVINGDEQDLKKEKDEDSKVDVQSDIQ
DQVEDKKVEEKDEKVSQSKDELVVESTSNIQEQEQKYMYLKAKWYQAFIHSKLKDFEKAE
EFAKHISDQIRCLKTPENYWKFELKALYLRSRQIAGCMEFRAAISIIDKDAKVLLEKLSE
HYYPKDHTEVKVEEGKEEEIQDSQQIKKVYQDRYHHEFRRQTVLYLKKFAYYDQAASQVI
QLIKDQAELYKIELIKSEDENQLPHIDLSQLSEQDQQTKSTQLHTIAKSLFILSKIYAFQ
IKVKEVFEISDNLEEFYKTLYKTENHIEVFKICRVKKDSILKSHSVRTPHRLDQAKDLLD
RCISILKVVLQCDEQTKTYYVATCCRDLGEIYLDKKQNDEAEKYILQSQRIIGEIFSDNH
PIIIEFNANLIELYAIKESEAERIKCSQIAEKNLEISKQYYGFRSIYSLKQELGYCSNLI
NVLKFQESQQHVAEMRQIVTKFHNDQSDLMNQYLFLAQILAGMTLMSTEVATSAEKILNY
VYQKQIEYCENDQEHPFLEQTLVNIGLFYRQCQRYQASLYYWNKLKAIQSKIFHHDREIL
VYTLKNIGLCYSQLDQFDKAEETFLEAVTIIEGLSSNPATMGSQETQKQDLEQLSSLYFS
VYQASITLGHKERSLEYNLKALEVNKKLYGENSINVSNNHYIHAQLLLKLGKPVEAIEWQ
NKALATLEGLEQSLANNQEEAEKSKTKPADIFIIRLKYFYQLVNMYFIANDLQNSIAQIN
KALDYVKNNDNLTYSNLEDVFRIRQELRAIERKASAKLQNTTALDIKQAEQKPTETVVVQ
QLKMSSMLGVFGLFTSSSFLASYLLMKNKQ