Identifiers and Description

Gene Model Identifier

Contig19331.0.g98

Standard Name

TPP1b

Aliases

Contig19331_0_g98

Description

Polynucleotide kinase 3 phosphatase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam08645 ) Polynucleotide kinase 3 phosphatase
  • ( pfam13271 ) Domain of unknown function (DUF4062)
  • ( pfam13419 ) Haloacid dehalogenase-like hydrolase
  • ( pfam00034 ) Cytochrome c
  • ( pfam04760 ) Translation initiation factor IF-2, N-terminal region

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001906905.998186291993296e-23DNA 3'-phosphatase family prot
ein
SGDYMR156C0.00010003404299092957TPP1 SGDID:S000004765, Chr XII
I from 571016-570300, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19331.0.g98(coding)
ATGAAGGATTAACAAGCCAGAAATGATTTAGAATTGGTTGACGATCAGGAAAAGAATAAA
GAAATTATTCAAAGTGTGAAAAGCACAAAGAACAAGAAAACTAGCAAAGAAGAAGTAAAA
GTTCATAATATTCTGCTTTCTGATGATTAAATCAAAAATCTATATCAATACTTGAGAAAG
ACTGTACTGTATATAGATTTATCTAACTTTTACAAGGATTATGAAAATTTGGATCATAAT
ATTCATAAAAATAATGATAAAACTTTGAAGATTGCTGGACTTGACTTGGATTCTACTTTG
ATTAAAGCTAAAGATGAAAAAAATATTCTGATTGAAGATGACTGGGTAATAATGTATAAA
ACAGTCCCAGATAAACTAAGGGAATTGTATAATTAGGGCTTTAAATTAGTTTTATTTACC
TAGCAAATAGCTTTCAGCAAGGGACTAAATGATGCATTTAGTTTTACAAGAAAAATGATC
AAAATCCAGCAGCAGATATAAGTACCCTTAGAAGTTTATGTGAGCACCAGTTTAGACTAC
TATCGCAAGCCCAGCTTAAGCTTCTGGAAGGTTTTTGAAGAACAAGAATAACAAAAGGGA
AATTTGATTGACTTAGGAAGTTCATTTTTTGTGGGGGACTGTGCAGGAAGAGCAGCCGAC
CCCAGAGATACTGACCTCAAATTTGCAATCAACATCGGCATTAAATTCTTCACACCCGAG
GAAATGTTTGTACCTAATTTCTAAAAAGACGCACATAAAATAGGGAAAAAAGCTCAGATT
CCGGATTTTACTAATTACTAAAAAGCAATTGAGATATTTAAAGGATAAGCTTCTATAGAT
CAAGATGAGATTAAGCAGATTTTAGAATATTTAGAAGAGTTTAAGGACAGTAAAAGTATC
GTTATTTTATCATAAACTTAACCTTTATAGATATATTTACTGGAACTTAATCAAATGAGC
AGCAAGTAATTTGGAACTAAAGAAGCTAGAAGAGCTATTGTTAAACTATTTGCATCACTA
GGGTATAAAATTCTGATGATTGAATTATTTCCATTTGATAACGACAAATAACAGCAAATT
TAAATCTGCTAACATTTCGACATGTTTAAGAAATTTAACAGAAATTATGAGGAACAAGAG
GAAGAGAAAATTAATGATAAAGTTACAAATAAATTTTTGCAATATGAAAATGAATTCAAG
AATTGCTTCTTATCTTATTAAAATGTTGCTGACAAAGAACTCAAAGAAATTTATGATTGT
GTGTAAGATGCTAATTAGGTGAAATACTTCTGCATTAAGGCCTCTATTAGGATTGAGTTA
TAATCTAAAGAGTTGGAAATGATGTGCTACAATTTAATATGA


>Contig19331.0.g98(protein)
MKDQQARNDLELVDDQEKNKEIIQSVKSTKNKKTSKEEVKVHNILLSDDQIKNLYQYLRK
TVLYIDLSNFYKDYENLDHNIHKNNDKTLKIAGLDLDSTLIKAKDEKNILIEDDWVIMYK
TVPDKLRELYNQGFKLVLFTQQIAFSKGLNDAFSFTRKMIKIQQQIQVPLEVYVSTSLDY
YRKPSLSFWKVFEEQEQQKGNLIDLGSSFFVGDCAGRAADPRDTDLKFAINIGIKFFTPE
EMFVPNFQKDAHKIGKKAQIPDFTNYQKAIEIFKGQASIDQDEIKQILEYLEEFKDSKSI
VILSQTQPLQIYLLELNQMSSKQFGTKEARRAIVKLFASLGYKILMIELFPFDNDKQQQI
QICQHFDMFKKFNRNYEEQEEEKINDKVTNKFLQYENEFKNCFLSYQNVADKELKEIYDC
VQDANQVKYFCIKASIRIELQSKELEMMCYNLI