Identifiers and Description

Gene Model Identifier

Contig12959.0.g59

Standard Name

TPP1a

Aliases

Contig12959_0_g59

Description

Polynucleotide kinase 3 phosphatase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001906903.0014466598835893e-101DNA 3'-phosphatase family prot
ein
SGDYMR156C5.000468829272308e-18TPP1 SGDID:S000004765, Chr XII
I from 571016-570300, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12959.0.g59(coding)
ATGGAAAGCAAAATCACTCCAAGAAGATCCGCAGTTGCTGCTGACAAGAACGCTAACTTA
CACAAAGATAGCAAAAAGAGAAAGGAAAATCCCTCTGACTTGAAGTAAGATGATACTAAG
AGACAATAAATGGGAGTTAGACACAAAGAAATAGATACATTGCTTGAAGTTGTCATTGGG
CCTTTTGAAGTTGACGAGAAAATTGCTAGTTTTGACTTGGATCATACTATCATCAAACCT
AAGTCAAATGCTAAATTCGGTCAATCACCTACTGATTGGGTATTTCTATATGATGGAAGT
GTGATTAAAGATAAACTCCATGAACTCAGCAAAGATGGGTACAGCATCGTGGTATTCACC
AATCAAGGAGGTGTTGAAGCTGGTCACACATCAGTCAAGGATCTTGTGAGGAAGTTTGAA
CTCATCCAAAAGGCTATCGGTCTACCTATGCTCTTTTTAGCTGCTACTCACAGCGATAAA
TATCGTAAACCTGCTCAGGGTGCTTGGGAATACTTTCTCAGTCAGTATGATAAAAGCAAA
AAGCTCAACATGAAGAAGAGCTTTTACTGCGGTGATGCAGCTGGAAGACCCAAAACAGCA
GACAGAAAGAAAGATTTCTCAGATACTGATAGAAAGTTTGCTATCAACATCGGATTGCCA
TTCGAGGTGCCAGAGCAAACTTTCCTTGGCGAGAAAGTCAGGATGCCCGCACTTTAATCA
GCATTGAAGTTTATCGAGGAGAAGAAGGAATCAAGCAAGAACCAGGAAGAAACTAAAAAT
CCAGAGAAAGTTGTTTACACTAGCGACAAGCAAGAAATTGTCTTGTTCTTTGGTGCTCCA
GGCTCAGGCAAGTCAACCTTCTGGAAGAATAACCTTTCTTCCTATGCTCGTGTTAATAAT
GACACTTTAAAGACCCCCGCTAAATGCATTAAAGTTGCTGAATAAGCATTGAATGAAAAG
AAGAGTGTAGTTATTGATAACACTAATTCAACTCTGGAATAAAGAAACAGATATACTGCA
ATCAGTAAAGCCCTTAACATCCCCATTAGATGCTTTATCTTTGATGTCCCCAAAGAAGTT
TGTATGCACAACAACAATCAGAGAAAGATCAATGCTCATAGGGAACATTTGAGCGGCAAA
GTTCCAGCAATCCCCATCCACAGTTTCTTCAAGAATAGTGAGAAACCAACAATGGCTGAA
GGATTCTCTGAAATTAAAACTATCAAGTTTTAAGCTGGACCATTTGATAATGATGAAGAT
AAGAAAACTTATTATTCTTTATCTTGA


>Contig12959.0.g59(protein)
MESKITPRRSAVAADKNANLHKDSKKRKENPSDLKQDDTKRQQMGVRHKEIDTLLEVVIG
PFEVDEKIASFDLDHTIIKPKSNAKFGQSPTDWVFLYDGSVIKDKLHELSKDGYSIVVFT
NQGGVEAGHTSVKDLVRKFELIQKAIGLPMLFLAATHSDKYRKPAQGAWEYFLSQYDKSK
KLNMKKSFYCGDAAGRPKTADRKKDFSDTDRKFAINIGLPFEVPEQTFLGEKVRMPALQS
ALKFIEEKKESSKNQEETKNPEKVVYTSDKQEIVLFFGAPGSGKSTFWKNNLSSYARVNN
DTLKTPAKCIKVAEQALNEKKSVVIDNTNSTLEQRNRYTAISKALNIPIRCFIFDVPKEV
CMHNNNQRKINAHREHLSGKVPAIPIHSFFKNSEKPTMAEGFSEIKTIKFQAGPFDNDED
KKTYYSLS