Identifiers and Description

Gene Model Identifier

Contig18880.0.g20

Standard Name

TPD1b

Aliases

Contig18880_0_g20

Description

Tyrosyl-DNA phosphodiesterase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005373209.9952060159684e-60Tyrosyl-DNA phosphodiesterase
family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18880.0.g20(coding)
ATGGAAGAGAGTAATAACTCAGCTCCCAATTAACCAGGAAGCAACAACAACACTAACAGT
AGACAGGTGAATAGTAAAAAGCGCTAAGAATGTACTAAGGAAAGCGATGTCAATCACTAA
TCAGTCTCAACCAGCAACTTGAGCAATTAAACTAATGCTCAGTCAAGCATGAATAGGGAT
AACTCTGGCAATCAGAATATTCATTAAAACTCACTTGCTAGTAAAAAGTAACCTAAACCT
GAGTAGATAGATCCAAGGGATTAAGATTTACTCAACAAATTCTTCAGCAGTGCTAATCTC
AATGATAACAGCGATGACTTTTAGCCTTAAGATAAGACTAAAGCATCACAGAATGGATTG
AGTCAGGAGAGTTAAATGAATAGAATCTAGTCAAAACTAAATTTTAGTCAGAATCCATTT
ACTCAGGAGCCATTCGACTAAGAAAGAGTGAAGATAATTGAGTTCAAGCTTCTAGAAGCA
AACCCATCAATCAAAAACTCATAAAGTAGCAAGGAAGAAGAAAAGCAAGGCGTTTCAGGC
ATGAGAAACTAAGAAATAACAGAGTAGATGATGATTGAGAGAATGCTTAATACTGAGAAG
GGTTCCAGCACATTGGAGTTGTCTTCGATAAGTGAGGATATGCTAAAGAACTATAATGAT
GGAAAACGCATTTTTGTCAATAGACTAAGATTCTATAATGATAAAGCGATTGAGGAGCAT
ATGATTTCATTCAAGCAACTAATGTACAAAGATCTAGGATTCAAAAACAAACTTAAAGGG
AAGAGTAGTATATAAAGAGCAATTCTAAGTACAATGGTCTTTGACATTGAGTTGATTACC
TAGCTTTTGGATGAAAAAATACCTATGACTATATTCTTGGATAGAGACAAGGATGACAAA
GGCCCTTAAGTTCTTTATGAGGAAAAACTAAATTTAAATTTTGTATTTCAATAGAAATGG
GGTGGTAATAGCTATAGTGTCTTTCACTCAAAGCTGATACTTTACGAGTTTGATGATAGA
CTTCGTGTGATAGTGACAAGTGCAAATCTCTACACTCAAGATTGGGAATTACTCTCCAAT
GTCACATGGTTCTAGGATTTCTTCAAAGCTGAGTTGGGCAAAAATAATGAAATATCTTAA
TCCTCAACAACACAGTCTGTAAAAGTAGCCACCAAAGAGGAAAGGAAAAATCCTTTCAAC
TTCAATGAGCAAAGGCCTCAACAGCAATAGCAACCCTTTTAAAACGATTTCAAGCAATAC
TTGAAAGATTACTTAGAAGTTATTATTCCTAAGAACGTTAAAGTTAGAGAGGTGTTTCGA
TAGAAAATTGACCTTGACAAGTTTGATTTTTCAACAGCAAATGCATTTCTGATTGCATCG
ATTAACGGTAGACATGCAGATAGAGAGTTCAAAAAGTATGGATAAGCGAGGCTTGGAGAA
TTAGTGAGAAACGTTGATAAACAGCATGAAAAAACAATCACCTACTAAACTTCTTCTATT
GGCAAACTAAATACGAAGTTTATGACTTCTATGTACAACTAATTCGGCAAAAGTAAGAAA
GTTAGTGAAGATATTCACTAAAATTTCAGAGTTATATTTCCCACAATTGGGTATGTGAGC
ACTAGTCACTTGGGACCTGAAAATGCTTCAAGTATTATTTTATAAGAAAGTTATTGGTAT
GATACTCCTGGATTCCCTAGAAAATCTTTTTACAGATAGGTAGGAAAATCAAAGTTACTT
GATAAAAATCTGTATCATACTAAGTTTATGATAATAACCGACAAAGGCAAAGAATCAGAA
ATAACAGATGATACAGTTTTGTACTTTGGCTCTCATAATTTCTCTGGAGGGGCCTGGGGT
AACTTAGAGAAGAATGATTCTTAGATATCTATTTCAAATTGGGAACTTGGAGTAGTATTC
GGGCCTTAAGTTGGTAGCTAAGAAATGAAATAGAAAATGATTAATAATATGGTATTATAG
TATCCACCTGAGAAATATTAAGAAAACGATCATCCTTTCATGAGACGTTGA


>Contig18880.0.g20(protein)
MEESNNSAPNQPGSNNNTNSRQVNSKKRQECTKESDVNHQSVSTSNLSNQTNAQSSMNRD
NSGNQNIHQNSLASKKQPKPEQIDPRDQDLLNKFFSSANLNDNSDDFQPQDKTKASQNGL
SQESQMNRIQSKLNFSQNPFTQEPFDQERVKIIEFKLLEANPSIKNSQSSKEEEKQGVSG
MRNQEITEQMMIERMLNTEKGSSTLELSSISEDMLKNYNDGKRIFVNRLRFYNDKAIEEH
MISFKQLMYKDLGFKNKLKGKSSIQRAILSTMVFDIELITQLLDEKIPMTIFLDRDKDDK
GPQVLYEEKLNLNFVFQQKWGGNSYSVFHSKLILYEFDDRLRVIVTSANLYTQDWELLSN
VTWFQDFFKAELGKNNEISQSSTTQSVKVATKEERKNPFNFNEQRPQQQQQPFQNDFKQY
LKDYLEVIIPKNVKVREVFRQKIDLDKFDFSTANAFLIASINGRHADREFKKYGQARLGE
LVRNVDKQHEKTITYQTSSIGKLNTKFMTSMYNQFGKSKKVSEDIHQNFRVIFPTIGYVS
TSHLGPENASSIILQESYWYDTPGFPRKSFYRQVGKSKLLDKNLYHTKFMIITDKGKESE
ITDDTVLYFGSHNFSGGAWGNLEKNDSQISISNWELGVVFGPQVGSQEMKQKMINNMVLQ
YPPEKYQENDHPFMRR