Identifiers and Description

Gene Model Identifier

Contig2894.0.g85

Standard Name

TP53I3b

Aliases

Contig2894_0_g85

Description

Alcohol dehydrogenase GroES-like domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam08240 ) Alcohol dehydrogenase GroES-like domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001490209.997019043202629e-21oxidoreductase, zinc-binding d
ehydrogenase fa...
SGDYBR046C0.0002999184360822198ZTA1 SGDID:S000000250, Chr II
from 331511-330507, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig2894.0.g85(coding)
ATGAAAGCTATCGTAGTGAAATAATTTGGAGGTCCAGAAATGCTTGAAATATCTGATTAG
GTTGAAATACCAAAATGCAACTAGAATGAAGTATTACTCAAAGTTGAAGCCACTGCAGTC
AATAGAGCAGACACTTTATAAAGGAAAGGAAAGTATCCACCCCCTAAAGGAGTCACAGAT
ATAATAGGTCTAGAGTGTGTGGGCTTTAAATCTGATCCACTTACACTTCAAGTTGATAAG
TCCCAATAATACATGGCTTTGCTTTCTGGTGGTTCTTATGCTCACTGCCATACCAGAAGT
TTGGGTTGA


>Contig2894.0.g85(protein)
MKAIVVKQFGGPEMLEISDQVEIPKCNQNEVLLKVEATAVNRADTLQRKGKYPPPKGVTD
IIGLECVGFKSDPLTLQVDKSQQYMALLSGGSYAHCHTRSLG